Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q1N1

Protein Details
Accession W6Q1N1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
205-228GVLKEEKKSEKKEEKLGKRKDLEWBasic
NLS Segment(s)
PositionSequence
210-224EKKSEKKEEKLGKRK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MSIETSESQTASSASTSGNITKAKEIIIPAETPTTKEEQEKEEEKEKEKEKDTSTSSIYSPGNLLSSLLAPFSFSAKSPEPTTAISPSNDKEKEKEKETTKSPTKISIDAPTSDSDSTTQPTPEPYYTPEETPLYKKLYKTRLTRTRTKQLLRAGERGYNDPPPPLGLGDCCGSSCDPCVRDLWKQEIGIWRERWGDRAVEEGEGVLKEEKKSEKKEEKLGKRKDLEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.13
5 0.17
6 0.19
7 0.2
8 0.22
9 0.23
10 0.22
11 0.22
12 0.22
13 0.2
14 0.2
15 0.19
16 0.18
17 0.23
18 0.22
19 0.21
20 0.23
21 0.23
22 0.23
23 0.26
24 0.28
25 0.26
26 0.33
27 0.36
28 0.39
29 0.44
30 0.46
31 0.46
32 0.51
33 0.53
34 0.52
35 0.52
36 0.53
37 0.48
38 0.51
39 0.5
40 0.46
41 0.43
42 0.38
43 0.34
44 0.33
45 0.3
46 0.24
47 0.2
48 0.16
49 0.15
50 0.12
51 0.12
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.07
59 0.08
60 0.08
61 0.07
62 0.12
63 0.14
64 0.17
65 0.18
66 0.19
67 0.19
68 0.2
69 0.22
70 0.21
71 0.2
72 0.19
73 0.2
74 0.19
75 0.25
76 0.26
77 0.25
78 0.25
79 0.31
80 0.35
81 0.37
82 0.43
83 0.4
84 0.44
85 0.47
86 0.53
87 0.51
88 0.51
89 0.47
90 0.47
91 0.44
92 0.4
93 0.38
94 0.33
95 0.29
96 0.25
97 0.26
98 0.2
99 0.2
100 0.17
101 0.15
102 0.12
103 0.11
104 0.11
105 0.1
106 0.1
107 0.09
108 0.11
109 0.13
110 0.13
111 0.13
112 0.14
113 0.19
114 0.2
115 0.21
116 0.21
117 0.2
118 0.21
119 0.23
120 0.24
121 0.23
122 0.24
123 0.26
124 0.31
125 0.38
126 0.44
127 0.48
128 0.56
129 0.6
130 0.64
131 0.71
132 0.72
133 0.74
134 0.74
135 0.7
136 0.66
137 0.64
138 0.68
139 0.62
140 0.6
141 0.52
142 0.47
143 0.46
144 0.42
145 0.38
146 0.33
147 0.29
148 0.24
149 0.22
150 0.2
151 0.19
152 0.16
153 0.14
154 0.1
155 0.11
156 0.11
157 0.11
158 0.1
159 0.11
160 0.11
161 0.11
162 0.13
163 0.16
164 0.16
165 0.17
166 0.19
167 0.22
168 0.27
169 0.31
170 0.34
171 0.34
172 0.34
173 0.37
174 0.42
175 0.42
176 0.44
177 0.41
178 0.38
179 0.4
180 0.4
181 0.39
182 0.33
183 0.31
184 0.24
185 0.28
186 0.26
187 0.2
188 0.2
189 0.17
190 0.16
191 0.14
192 0.15
193 0.13
194 0.15
195 0.15
196 0.2
197 0.29
198 0.35
199 0.42
200 0.51
201 0.58
202 0.63
203 0.72
204 0.78
205 0.81
206 0.83
207 0.86
208 0.85