Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q984

Protein Details
Accession W6Q984   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-71AEDETRSRKRKRTEKKKPSALDNAFHydrophilic
NLS Segment(s)
PositionSequence
52-65RSRKRKRTEKKKPS
79-88RHKVKRLKKE
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASHSNTIIIANDEKLPNLQPGSPQPQRAPRCNNSYEDSEGMFIDAAEDETRSRKRKRTEKKKPSALDNAFQLLNKEVRHKVKRLKKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.18
5 0.18
6 0.17
7 0.17
8 0.23
9 0.31
10 0.33
11 0.35
12 0.37
13 0.45
14 0.5
15 0.54
16 0.57
17 0.54
18 0.58
19 0.57
20 0.56
21 0.5
22 0.47
23 0.42
24 0.34
25 0.28
26 0.22
27 0.19
28 0.15
29 0.12
30 0.08
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.09
38 0.14
39 0.2
40 0.25
41 0.32
42 0.42
43 0.52
44 0.63
45 0.71
46 0.77
47 0.83
48 0.89
49 0.92
50 0.87
51 0.84
52 0.83
53 0.76
54 0.69
55 0.61
56 0.53
57 0.43
58 0.39
59 0.32
60 0.25
61 0.24
62 0.21
63 0.24
64 0.29
65 0.39
66 0.45
67 0.52
68 0.59
69 0.66