Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Q2H2

Protein Details
Accession W6Q2H2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-33PKETTTKTTRKAPEKRVQRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
11-30RKAPEKRVQRRKKDPNAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTTKTTRKAPEKRVQRRKKDPNAPKRGLSAYMFFANDNRDKVREENPGISFGQVGKQLGDKWKALSETDRKPYDAKAAADKKRYEEEKAAYLAKAEEEEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.87
4 0.88
5 0.9
6 0.9
7 0.92
8 0.93
9 0.94
10 0.93
11 0.93
12 0.93
13 0.93
14 0.86
15 0.78
16 0.71
17 0.62
18 0.55
19 0.46
20 0.37
21 0.29
22 0.26
23 0.24
24 0.2
25 0.19
26 0.19
27 0.19
28 0.19
29 0.18
30 0.17
31 0.18
32 0.21
33 0.25
34 0.27
35 0.27
36 0.3
37 0.29
38 0.3
39 0.28
40 0.25
41 0.21
42 0.14
43 0.14
44 0.11
45 0.1
46 0.08
47 0.09
48 0.11
49 0.15
50 0.18
51 0.16
52 0.16
53 0.19
54 0.19
55 0.19
56 0.24
57 0.27
58 0.31
59 0.38
60 0.39
61 0.38
62 0.38
63 0.39
64 0.39
65 0.37
66 0.32
67 0.34
68 0.42
69 0.46
70 0.52
71 0.52
72 0.49
73 0.53
74 0.54
75 0.49
76 0.46
77 0.44
78 0.42
79 0.44
80 0.42
81 0.33
82 0.32
83 0.27
84 0.21
85 0.18
86 0.14
87 0.12
88 0.13