Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q2T9

Protein Details
Accession W6Q2T9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
100-123QVRHADCRQPTCRRYKKKFFAADGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
PF13561  adh_short_C2  
CDD cd05233  SDR_c  
Amino Acid Sequences MAALTEKVAIITGGSNGIGKATALRLTRDGAKVVIQYRSRRCCVLDSEELIRRTVEKFGQIDIVIANAGSLPLHDLANTSEQDFNDSIDLNVKGPYFLVQVRHADCRQPTCRRYKKKFFAADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.06
7 0.07
8 0.08
9 0.12
10 0.13
11 0.15
12 0.17
13 0.19
14 0.23
15 0.24
16 0.23
17 0.19
18 0.2
19 0.21
20 0.22
21 0.27
22 0.28
23 0.33
24 0.41
25 0.46
26 0.46
27 0.45
28 0.44
29 0.4
30 0.4
31 0.39
32 0.34
33 0.31
34 0.33
35 0.37
36 0.36
37 0.33
38 0.28
39 0.23
40 0.2
41 0.19
42 0.15
43 0.14
44 0.14
45 0.14
46 0.15
47 0.14
48 0.13
49 0.11
50 0.1
51 0.06
52 0.05
53 0.05
54 0.03
55 0.03
56 0.02
57 0.02
58 0.03
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.1
65 0.11
66 0.11
67 0.12
68 0.12
69 0.15
70 0.15
71 0.14
72 0.12
73 0.12
74 0.11
75 0.12
76 0.13
77 0.11
78 0.12
79 0.12
80 0.11
81 0.11
82 0.12
83 0.11
84 0.12
85 0.15
86 0.17
87 0.23
88 0.26
89 0.32
90 0.32
91 0.35
92 0.38
93 0.43
94 0.48
95 0.52
96 0.56
97 0.61
98 0.71
99 0.76
100 0.83
101 0.85
102 0.87
103 0.88