Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CQW3

Protein Details
Accession Q6CQW3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MASVRKRKMAKSSVKKVSRRNKDKQKQVNIKGNPIIHydrophilic
NLS Segment(s)
PositionSequence
5-26RKRKMAKSSVKKVSRRNKDKQK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
KEGG kla:KLLA0_D13750g  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MASVRKRKMAKSSVKKVSRRNKDKQKQVNIKGNPIIAENWDYSLTLAQNYKKLGLKVKMGKFAGGEEADLSKVIKKDVYEHSAFSDDESEDEKDSQGEEDEDDVNLEELNSDGEYDESKIPEGEARIKRDDDGNIVKVYYGKRKAIDIDMDVEELRRENEKNEVKTEVVKKLEAYASRPVAKKERGLSQREDQWLEQLYKKHGDNYKKMFFDKKLNVYQQTENVLRRKILKWKELHNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.87
5 0.87
6 0.86
7 0.87
8 0.88
9 0.88
10 0.92
11 0.92
12 0.92
13 0.92
14 0.92
15 0.91
16 0.84
17 0.81
18 0.74
19 0.65
20 0.54
21 0.45
22 0.36
23 0.28
24 0.27
25 0.19
26 0.17
27 0.16
28 0.15
29 0.14
30 0.15
31 0.13
32 0.13
33 0.16
34 0.17
35 0.2
36 0.21
37 0.25
38 0.26
39 0.28
40 0.34
41 0.34
42 0.41
43 0.46
44 0.5
45 0.54
46 0.51
47 0.49
48 0.41
49 0.38
50 0.33
51 0.24
52 0.19
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.16
64 0.22
65 0.27
66 0.26
67 0.26
68 0.27
69 0.28
70 0.27
71 0.22
72 0.18
73 0.12
74 0.12
75 0.14
76 0.13
77 0.11
78 0.12
79 0.11
80 0.1
81 0.1
82 0.09
83 0.07
84 0.07
85 0.06
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.03
95 0.03
96 0.04
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.06
103 0.07
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.16
111 0.19
112 0.23
113 0.25
114 0.25
115 0.26
116 0.27
117 0.26
118 0.22
119 0.22
120 0.2
121 0.18
122 0.18
123 0.17
124 0.18
125 0.19
126 0.22
127 0.22
128 0.23
129 0.24
130 0.25
131 0.27
132 0.28
133 0.28
134 0.21
135 0.21
136 0.19
137 0.19
138 0.17
139 0.15
140 0.12
141 0.1
142 0.1
143 0.09
144 0.1
145 0.1
146 0.2
147 0.26
148 0.29
149 0.31
150 0.32
151 0.3
152 0.36
153 0.4
154 0.36
155 0.31
156 0.3
157 0.27
158 0.28
159 0.31
160 0.26
161 0.25
162 0.26
163 0.29
164 0.34
165 0.35
166 0.36
167 0.4
168 0.42
169 0.44
170 0.41
171 0.46
172 0.48
173 0.52
174 0.54
175 0.53
176 0.57
177 0.56
178 0.55
179 0.45
180 0.42
181 0.42
182 0.39
183 0.36
184 0.33
185 0.32
186 0.35
187 0.35
188 0.39
189 0.42
190 0.48
191 0.53
192 0.58
193 0.62
194 0.6
195 0.63
196 0.62
197 0.59
198 0.61
199 0.6
200 0.6
201 0.6
202 0.63
203 0.66
204 0.64
205 0.64
206 0.58
207 0.56
208 0.54
209 0.51
210 0.5
211 0.47
212 0.45
213 0.46
214 0.46
215 0.5
216 0.53
217 0.56
218 0.57
219 0.62