Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6PRZ4

Protein Details
Accession W6PRZ4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNIPKTRRTYCKSKECHKHQQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKSKECHKHQQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKAKKQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.83
4 0.88
5 0.88
6 0.89
7 0.88
8 0.9
9 0.88
10 0.87
11 0.86
12 0.79
13 0.76
14 0.7
15 0.66
16 0.59
17 0.53
18 0.43
19 0.36
20 0.34
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.51
61 0.46
62 0.46
63 0.4
64 0.37
65 0.37
66 0.36
67 0.38
68 0.47
69 0.52
70 0.53
71 0.63
72 0.68
73 0.74
74 0.75
75 0.71
76 0.65
77 0.58
78 0.56
79 0.56
80 0.56
81 0.54
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42