Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R977

Protein Details
Accession W6R977   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-35RSNGSSSKRKSMRQKQGRRKSNLIKKAREHydrophilic
NLS Segment(s)
PositionSequence
13-33SKRKSMRQKQGRRKSNLIKKA
Subcellular Location(s) mito 12, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MATTGPRSNGSSSKRKSMRQKQGRRKSNLIKKAREYSRLCEADVCVGIRLRRTGQVFILSADVSGFWGFLGPLIIRPHFLITDQDLENAEEGIIRKPSEANLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.7
4 0.74
5 0.78
6 0.79
7 0.86
8 0.87
9 0.92
10 0.93
11 0.9
12 0.88
13 0.88
14 0.87
15 0.86
16 0.84
17 0.8
18 0.77
19 0.78
20 0.73
21 0.72
22 0.65
23 0.59
24 0.6
25 0.54
26 0.47
27 0.39
28 0.34
29 0.28
30 0.25
31 0.21
32 0.12
33 0.12
34 0.12
35 0.12
36 0.13
37 0.11
38 0.15
39 0.16
40 0.16
41 0.16
42 0.18
43 0.17
44 0.16
45 0.16
46 0.12
47 0.1
48 0.09
49 0.08
50 0.06
51 0.05
52 0.04
53 0.03
54 0.04
55 0.03
56 0.04
57 0.05
58 0.05
59 0.09
60 0.11
61 0.12
62 0.13
63 0.14
64 0.15
65 0.14
66 0.15
67 0.14
68 0.14
69 0.19
70 0.18
71 0.19
72 0.18
73 0.19
74 0.18
75 0.16
76 0.12
77 0.1
78 0.1
79 0.13
80 0.14
81 0.14
82 0.15
83 0.15
84 0.17