Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H996

Protein Details
Accession C1H996    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPSHKTFRTKQKLAKAQKRNRPIPQWIRLRTHydrophilic
NLS Segment(s)
PositionSequence
18-18K
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbl:PAAG_07337  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKTFRTKQKLAKAQKRNRPIPQWIRLRTGNTIRCGKAGLGGGKEWTERKRNIGEKMEWRDRYMKERGVEMDGEIQCPKIDVSPPFQRHRPVHCKHHVLQKMSQKSSIARWKWDTGCIENAKRNILANRNLLFPNTDITPSGDIGARLVSAFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.88
5 0.9
6 0.88
7 0.87
8 0.84
9 0.84
10 0.83
11 0.82
12 0.83
13 0.77
14 0.73
15 0.68
16 0.64
17 0.6
18 0.59
19 0.56
20 0.52
21 0.53
22 0.48
23 0.44
24 0.42
25 0.35
26 0.29
27 0.28
28 0.24
29 0.2
30 0.19
31 0.2
32 0.19
33 0.21
34 0.2
35 0.21
36 0.25
37 0.25
38 0.29
39 0.36
40 0.41
41 0.46
42 0.49
43 0.5
44 0.52
45 0.59
46 0.63
47 0.56
48 0.52
49 0.51
50 0.47
51 0.47
52 0.43
53 0.39
54 0.32
55 0.33
56 0.32
57 0.27
58 0.26
59 0.2
60 0.22
61 0.17
62 0.17
63 0.15
64 0.14
65 0.12
66 0.12
67 0.12
68 0.06
69 0.09
70 0.09
71 0.15
72 0.24
73 0.3
74 0.33
75 0.36
76 0.42
77 0.43
78 0.51
79 0.55
80 0.53
81 0.58
82 0.62
83 0.66
84 0.63
85 0.69
86 0.65
87 0.6
88 0.6
89 0.59
90 0.6
91 0.55
92 0.53
93 0.44
94 0.4
95 0.44
96 0.47
97 0.4
98 0.37
99 0.4
100 0.44
101 0.44
102 0.48
103 0.44
104 0.37
105 0.42
106 0.43
107 0.43
108 0.42
109 0.43
110 0.4
111 0.37
112 0.38
113 0.36
114 0.37
115 0.38
116 0.4
117 0.4
118 0.41
119 0.4
120 0.37
121 0.33
122 0.27
123 0.24
124 0.18
125 0.18
126 0.15
127 0.17
128 0.19
129 0.17
130 0.18
131 0.16
132 0.15
133 0.14
134 0.14
135 0.11