Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6PTE7

Protein Details
Accession W6PTE7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-90INSNKKKAAKAKAAANKKKTHydrophilic
NLS Segment(s)
PositionSequence
75-90KKKAAKAKAAANKKKT
Subcellular Location(s) plas 15, mito 4, E.R. 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLGQLVGSVMLLVATAIFLYYTAWTLLMPFVDPGHPLHDIFPPRVWAIRIPVILTLLASAVVGTFIGIVMINSNKKKAAKAKAAANKKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.1
22 0.11
23 0.11
24 0.12
25 0.15
26 0.17
27 0.17
28 0.17
29 0.16
30 0.16
31 0.17
32 0.16
33 0.12
34 0.14
35 0.16
36 0.16
37 0.14
38 0.14
39 0.14
40 0.13
41 0.12
42 0.09
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.05
57 0.08
58 0.14
59 0.15
60 0.17
61 0.21
62 0.23
63 0.3
64 0.37
65 0.44
66 0.49
67 0.54
68 0.63
69 0.68
70 0.78