Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R2S7

Protein Details
Accession W6R2S7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
136-158RDENENKKQKRARSRRQIPAEEGBasic
NLS Segment(s)
PositionSequence
142-150KKQKRARSR
Subcellular Location(s) nucl 12, mito 10.5, cyto_mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKMQTGINYINKLEFLEVYPSVRIEAFKSETIKNSFSAAGLIPFLPDRVLSKLNIYLRTLTPPLSRGSDLSRNFTPKTPFNSKDLRRQALSIKALLRTQSRSLISPSKRALNQLIKGCELAMHSAILLAKENKDLRDENENKKQKRARSRRQIPAEEGLSVQEASEIIARLVEALEIPLHPPGGSTQSGLEPRPRAAPRCSGCGKTGHKIISSWVGWPLAYSGHSLTDYVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.17
4 0.17
5 0.18
6 0.19
7 0.18
8 0.18
9 0.18
10 0.17
11 0.14
12 0.19
13 0.2
14 0.23
15 0.27
16 0.29
17 0.34
18 0.37
19 0.37
20 0.32
21 0.3
22 0.26
23 0.23
24 0.22
25 0.16
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.09
32 0.08
33 0.08
34 0.09
35 0.12
36 0.14
37 0.14
38 0.17
39 0.22
40 0.26
41 0.28
42 0.28
43 0.27
44 0.26
45 0.3
46 0.28
47 0.25
48 0.22
49 0.22
50 0.22
51 0.22
52 0.22
53 0.19
54 0.24
55 0.29
56 0.29
57 0.33
58 0.34
59 0.35
60 0.36
61 0.38
62 0.37
63 0.34
64 0.4
65 0.43
66 0.42
67 0.43
68 0.51
69 0.51
70 0.57
71 0.59
72 0.55
73 0.48
74 0.48
75 0.47
76 0.44
77 0.42
78 0.35
79 0.29
80 0.27
81 0.27
82 0.27
83 0.25
84 0.21
85 0.21
86 0.22
87 0.22
88 0.21
89 0.24
90 0.3
91 0.29
92 0.31
93 0.31
94 0.32
95 0.31
96 0.32
97 0.35
98 0.33
99 0.36
100 0.35
101 0.35
102 0.31
103 0.3
104 0.28
105 0.22
106 0.17
107 0.12
108 0.08
109 0.06
110 0.06
111 0.06
112 0.07
113 0.06
114 0.07
115 0.07
116 0.07
117 0.11
118 0.13
119 0.13
120 0.15
121 0.16
122 0.17
123 0.27
124 0.33
125 0.36
126 0.45
127 0.53
128 0.52
129 0.59
130 0.62
131 0.59
132 0.65
133 0.69
134 0.69
135 0.72
136 0.81
137 0.83
138 0.87
139 0.84
140 0.76
141 0.71
142 0.62
143 0.51
144 0.41
145 0.31
146 0.23
147 0.18
148 0.13
149 0.08
150 0.06
151 0.06
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.07
168 0.07
169 0.08
170 0.12
171 0.12
172 0.12
173 0.13
174 0.18
175 0.21
176 0.22
177 0.26
178 0.24
179 0.25
180 0.33
181 0.36
182 0.36
183 0.38
184 0.46
185 0.43
186 0.49
187 0.52
188 0.47
189 0.45
190 0.49
191 0.5
192 0.48
193 0.51
194 0.46
195 0.43
196 0.4
197 0.42
198 0.41
199 0.35
200 0.3
201 0.27
202 0.24
203 0.22
204 0.22
205 0.2
206 0.14
207 0.14
208 0.14
209 0.12
210 0.14
211 0.15