Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QA01

Protein Details
Accession W6QA01    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-32TMKTTNRSSRKLLRQKQCRRKTSLMKKAYEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.666, mito 11.5, nucl 10.5, cyto_nucl 8.833, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MNTMKTTNRSSRKLLRQKQCRRKTSLMKKAYEYSKLCNADVCMGIRMRETGQVHILSADSSGFWAFLALQLNSYYPTPTLTSDRDFEKSGEDVKVQTMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.82
4 0.88
5 0.92
6 0.92
7 0.89
8 0.86
9 0.86
10 0.87
11 0.87
12 0.86
13 0.83
14 0.76
15 0.72
16 0.7
17 0.64
18 0.61
19 0.52
20 0.46
21 0.46
22 0.44
23 0.4
24 0.34
25 0.31
26 0.25
27 0.25
28 0.21
29 0.14
30 0.13
31 0.13
32 0.12
33 0.12
34 0.1
35 0.14
36 0.14
37 0.13
38 0.15
39 0.15
40 0.15
41 0.14
42 0.14
43 0.09
44 0.08
45 0.07
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.06
54 0.09
55 0.08
56 0.09
57 0.09
58 0.1
59 0.11
60 0.12
61 0.11
62 0.08
63 0.1
64 0.11
65 0.13
66 0.17
67 0.19
68 0.22
69 0.24
70 0.28
71 0.29
72 0.29
73 0.27
74 0.26
75 0.25
76 0.25
77 0.25
78 0.23
79 0.21