Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QB93

Protein Details
Accession W6QB93   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-41GAASRRQYPKQPAPPPRGPRKAPKETKAHydrophilic
NLS Segment(s)
PositionSequence
9-41AKSAAGAASRRQYPKQPAPPPRGPRKAPKETKA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGSAASKPAKSAAGAASRRQYPKQPAPPPRGPRKAPKETKAASAPTPTSAPKPNAGPSPPQTPAPSSQGPKYHSKEKASDVKSDAIDMDGRDPHFAASLRSIGPVDPSPTYSNSSTFNRGSMQTVFPQASNPALLVVTARQRLTEAADKEAEHFGHAGHPGRSFLDAVTIQQVLTMRDKQGKRRGDIERFLGLKKGVLDRLGKDGVVSRIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.45
5 0.49
6 0.5
7 0.52
8 0.53
9 0.6
10 0.66
11 0.7
12 0.73
13 0.77
14 0.84
15 0.85
16 0.86
17 0.85
18 0.8
19 0.81
20 0.81
21 0.83
22 0.83
23 0.78
24 0.77
25 0.7
26 0.71
27 0.66
28 0.59
29 0.51
30 0.46
31 0.41
32 0.34
33 0.34
34 0.28
35 0.27
36 0.29
37 0.29
38 0.28
39 0.3
40 0.32
41 0.34
42 0.35
43 0.37
44 0.35
45 0.39
46 0.37
47 0.37
48 0.34
49 0.32
50 0.33
51 0.33
52 0.34
53 0.3
54 0.33
55 0.36
56 0.38
57 0.44
58 0.45
59 0.48
60 0.48
61 0.5
62 0.49
63 0.5
64 0.56
65 0.5
66 0.49
67 0.43
68 0.41
69 0.37
70 0.33
71 0.27
72 0.18
73 0.17
74 0.13
75 0.12
76 0.1
77 0.11
78 0.1
79 0.11
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.08
90 0.1
91 0.1
92 0.1
93 0.09
94 0.11
95 0.12
96 0.13
97 0.17
98 0.15
99 0.16
100 0.18
101 0.2
102 0.22
103 0.21
104 0.2
105 0.19
106 0.19
107 0.2
108 0.18
109 0.18
110 0.15
111 0.17
112 0.17
113 0.15
114 0.15
115 0.14
116 0.12
117 0.11
118 0.09
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.1
125 0.13
126 0.13
127 0.12
128 0.13
129 0.14
130 0.18
131 0.22
132 0.2
133 0.21
134 0.22
135 0.23
136 0.24
137 0.26
138 0.22
139 0.16
140 0.14
141 0.11
142 0.12
143 0.15
144 0.16
145 0.15
146 0.16
147 0.16
148 0.17
149 0.18
150 0.16
151 0.13
152 0.15
153 0.14
154 0.14
155 0.15
156 0.15
157 0.13
158 0.14
159 0.15
160 0.13
161 0.17
162 0.19
163 0.2
164 0.28
165 0.32
166 0.4
167 0.48
168 0.53
169 0.53
170 0.59
171 0.65
172 0.65
173 0.67
174 0.63
175 0.62
176 0.57
177 0.53
178 0.48
179 0.39
180 0.33
181 0.31
182 0.31
183 0.26
184 0.28
185 0.31
186 0.3
187 0.36
188 0.35
189 0.31
190 0.27
191 0.29