Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q9C5

Protein Details
Accession W6Q9C5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-34MSPLRIPNISRNRRDQCRRRVKCDKQDLPCLNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
CDD cd00067  GAL4  
Amino Acid Sequences MMSPLRIPNISRNRRDQCRRRVKCDKQDLPCLNCMSPELDCTYLKGMVCNAASSRPQSHTVPISYSKSGSSPWQGGVNSPESKHSRSRQVNDMELIHKYSTETYRSLSANDSENSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.83
3 0.83
4 0.83
5 0.85
6 0.87
7 0.87
8 0.89
9 0.89
10 0.89
11 0.9
12 0.88
13 0.83
14 0.85
15 0.82
16 0.74
17 0.69
18 0.61
19 0.5
20 0.41
21 0.35
22 0.26
23 0.2
24 0.17
25 0.14
26 0.14
27 0.14
28 0.14
29 0.15
30 0.15
31 0.15
32 0.14
33 0.12
34 0.12
35 0.13
36 0.12
37 0.11
38 0.11
39 0.12
40 0.14
41 0.15
42 0.15
43 0.18
44 0.18
45 0.2
46 0.2
47 0.2
48 0.2
49 0.22
50 0.22
51 0.2
52 0.2
53 0.18
54 0.16
55 0.16
56 0.16
57 0.16
58 0.14
59 0.15
60 0.18
61 0.17
62 0.18
63 0.2
64 0.22
65 0.21
66 0.2
67 0.25
68 0.25
69 0.28
70 0.35
71 0.37
72 0.43
73 0.49
74 0.54
75 0.56
76 0.58
77 0.59
78 0.54
79 0.52
80 0.44
81 0.37
82 0.34
83 0.26
84 0.21
85 0.18
86 0.19
87 0.2
88 0.21
89 0.21
90 0.21
91 0.25
92 0.26
93 0.26
94 0.25
95 0.24
96 0.26