Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QD37

Protein Details
Accession W6QD37   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-72NDPNTSARRRRRSQDSARAGFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 5, mito 3, E.R. 3, nucl 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018908  TMEM234  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10639  TMEM234  
Amino Acid Sequences MDPDPGIPIEPAPSVFNYVLSFLLVGVAWGFTTPFIRRAAADFNARQAKQANDPNTSARRRRRSQDSARAGFTDAGEAQELLSREEEDSDSGADVPRRSTSSDVNRKPKTAGQDTGLAEQSGSRDREDREGGADEDEDDVPMPAWRHGGPVKQSWLRAKIVSVFWTVVNLLRTPAYAIPLVINLTGSIWFFLLVGKHELSLTVPLANSSAFLFTVLGEWYVDRKVIAKETWLGMGLVLGGIALCVHSKNQAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.17
5 0.17
6 0.16
7 0.14
8 0.13
9 0.08
10 0.09
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.08
20 0.1
21 0.13
22 0.15
23 0.16
24 0.17
25 0.2
26 0.25
27 0.25
28 0.31
29 0.28
30 0.35
31 0.42
32 0.41
33 0.4
34 0.38
35 0.37
36 0.38
37 0.45
38 0.42
39 0.38
40 0.4
41 0.45
42 0.49
43 0.53
44 0.54
45 0.56
46 0.61
47 0.63
48 0.7
49 0.73
50 0.76
51 0.79
52 0.81
53 0.81
54 0.76
55 0.71
56 0.64
57 0.55
58 0.46
59 0.35
60 0.26
61 0.16
62 0.13
63 0.11
64 0.1
65 0.09
66 0.1
67 0.1
68 0.09
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.08
75 0.09
76 0.08
77 0.08
78 0.07
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.12
85 0.13
86 0.15
87 0.2
88 0.29
89 0.39
90 0.46
91 0.54
92 0.55
93 0.55
94 0.55
95 0.51
96 0.47
97 0.42
98 0.37
99 0.29
100 0.33
101 0.33
102 0.33
103 0.31
104 0.23
105 0.18
106 0.16
107 0.15
108 0.12
109 0.12
110 0.1
111 0.12
112 0.13
113 0.17
114 0.18
115 0.17
116 0.15
117 0.16
118 0.16
119 0.14
120 0.13
121 0.1
122 0.1
123 0.1
124 0.08
125 0.06
126 0.06
127 0.05
128 0.07
129 0.07
130 0.06
131 0.07
132 0.07
133 0.11
134 0.13
135 0.16
136 0.18
137 0.21
138 0.27
139 0.28
140 0.32
141 0.33
142 0.35
143 0.33
144 0.3
145 0.28
146 0.26
147 0.25
148 0.23
149 0.2
150 0.17
151 0.15
152 0.15
153 0.15
154 0.13
155 0.13
156 0.11
157 0.1
158 0.1
159 0.1
160 0.11
161 0.11
162 0.11
163 0.1
164 0.1
165 0.09
166 0.1
167 0.1
168 0.09
169 0.08
170 0.06
171 0.06
172 0.07
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.07
179 0.07
180 0.08
181 0.11
182 0.11
183 0.11
184 0.11
185 0.12
186 0.12
187 0.13
188 0.12
189 0.1
190 0.1
191 0.1
192 0.11
193 0.1
194 0.1
195 0.08
196 0.08
197 0.07
198 0.07
199 0.07
200 0.07
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.09
207 0.1
208 0.1
209 0.09
210 0.12
211 0.14
212 0.19
213 0.19
214 0.21
215 0.24
216 0.25
217 0.26
218 0.24
219 0.21
220 0.16
221 0.15
222 0.12
223 0.08
224 0.06
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.05
232 0.06