Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PUM6

Protein Details
Accession W6PUM6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-93PSSPVTPKKRAPRKKANETPTPAHydrophilic
NLS Segment(s)
PositionSequence
77-102PKKRAPRKKANETPTPAGSSRKRKRV
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKVKWDSIADQTLLAKILETHDLSVDVAKVAEAWPVEDEDHRPTPRALKERLNKIRENVRNGNVAAVSGPSSPVTPKKRAPRKKANETPTPAGSSRKRKRVTKNAIADEDQVNVREEEELPAKHEHSLDESAIKQEAGLEGLAPLLQWNLKEGSPDVDNKKVDPEWTEYNEEDAYSDDQLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.14
4 0.1
5 0.12
6 0.14
7 0.14
8 0.14
9 0.13
10 0.14
11 0.14
12 0.14
13 0.13
14 0.09
15 0.08
16 0.07
17 0.07
18 0.06
19 0.08
20 0.07
21 0.08
22 0.08
23 0.1
24 0.11
25 0.12
26 0.14
27 0.18
28 0.24
29 0.24
30 0.25
31 0.25
32 0.31
33 0.37
34 0.42
35 0.4
36 0.44
37 0.51
38 0.61
39 0.69
40 0.67
41 0.63
42 0.61
43 0.66
44 0.63
45 0.63
46 0.58
47 0.51
48 0.49
49 0.47
50 0.43
51 0.33
52 0.26
53 0.18
54 0.12
55 0.1
56 0.07
57 0.07
58 0.06
59 0.06
60 0.08
61 0.15
62 0.2
63 0.24
64 0.3
65 0.4
66 0.51
67 0.6
68 0.68
69 0.72
70 0.77
71 0.83
72 0.86
73 0.83
74 0.8
75 0.76
76 0.7
77 0.6
78 0.53
79 0.42
80 0.39
81 0.39
82 0.41
83 0.43
84 0.49
85 0.54
86 0.59
87 0.68
88 0.73
89 0.77
90 0.76
91 0.77
92 0.73
93 0.7
94 0.63
95 0.56
96 0.45
97 0.37
98 0.27
99 0.19
100 0.15
101 0.12
102 0.11
103 0.09
104 0.09
105 0.1
106 0.13
107 0.12
108 0.14
109 0.16
110 0.17
111 0.17
112 0.17
113 0.15
114 0.16
115 0.18
116 0.16
117 0.16
118 0.16
119 0.16
120 0.16
121 0.15
122 0.11
123 0.1
124 0.09
125 0.08
126 0.07
127 0.06
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.08
137 0.1
138 0.1
139 0.12
140 0.13
141 0.16
142 0.18
143 0.24
144 0.27
145 0.32
146 0.33
147 0.32
148 0.37
149 0.34
150 0.34
151 0.31
152 0.32
153 0.32
154 0.36
155 0.4
156 0.35
157 0.37
158 0.35
159 0.31
160 0.26
161 0.21
162 0.19