Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K043

Protein Details
Accession W4K043    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
193-227LMNSIKKYDRLRKWAHKQKAHKKLKDRMRKSADPPBasic
NLS Segment(s)
PositionSequence
199-222KYDRLRKWAHKQKAHKKLKDRMRK
Subcellular Location(s) nucl 21, cyto_nucl 15.5, cyto 6
Family & Domain DBs
KEGG hir:HETIRDRAFT_436099  -  
Amino Acid Sequences MSAPGNDINDSPVGLDRRLRGLEQQVANLRNAKRESERKCFEATQRGQRLASELGFGNIEEAEENISIYPQLYNRATIEYNSTRVALLEQQLNRLQELRKGDFNKNQELSRAVASLRQENEELRTQPVNPADRRVNHADLREFFQAVSHASVPTSVESSSIAERLVDTQEELSELQKRYDSLLEVKERATKELMNSIKKYDRLRKWAHKQKAHKKLKDRMRKSADPPFSTPQSRFPSPSDLNNAPAPFDSPTNPRLAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.22
4 0.27
5 0.29
6 0.29
7 0.29
8 0.34
9 0.41
10 0.39
11 0.43
12 0.44
13 0.44
14 0.45
15 0.46
16 0.4
17 0.39
18 0.39
19 0.38
20 0.4
21 0.48
22 0.54
23 0.57
24 0.61
25 0.57
26 0.6
27 0.6
28 0.57
29 0.58
30 0.58
31 0.58
32 0.59
33 0.59
34 0.54
35 0.5
36 0.47
37 0.39
38 0.32
39 0.24
40 0.17
41 0.15
42 0.15
43 0.15
44 0.12
45 0.08
46 0.08
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.12
59 0.13
60 0.14
61 0.15
62 0.18
63 0.18
64 0.17
65 0.24
66 0.21
67 0.22
68 0.21
69 0.21
70 0.18
71 0.17
72 0.18
73 0.13
74 0.13
75 0.17
76 0.16
77 0.19
78 0.22
79 0.22
80 0.22
81 0.22
82 0.2
83 0.19
84 0.24
85 0.24
86 0.28
87 0.32
88 0.37
89 0.4
90 0.43
91 0.46
92 0.43
93 0.41
94 0.36
95 0.33
96 0.29
97 0.23
98 0.21
99 0.13
100 0.13
101 0.14
102 0.17
103 0.16
104 0.16
105 0.15
106 0.15
107 0.18
108 0.19
109 0.19
110 0.17
111 0.17
112 0.16
113 0.18
114 0.22
115 0.24
116 0.21
117 0.25
118 0.26
119 0.27
120 0.32
121 0.33
122 0.33
123 0.3
124 0.32
125 0.31
126 0.29
127 0.31
128 0.27
129 0.23
130 0.18
131 0.16
132 0.15
133 0.12
134 0.12
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.06
143 0.06
144 0.07
145 0.08
146 0.09
147 0.08
148 0.08
149 0.07
150 0.07
151 0.08
152 0.09
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.08
159 0.09
160 0.13
161 0.14
162 0.15
163 0.15
164 0.16
165 0.17
166 0.18
167 0.18
168 0.17
169 0.22
170 0.25
171 0.25
172 0.26
173 0.29
174 0.28
175 0.28
176 0.26
177 0.22
178 0.2
179 0.27
180 0.32
181 0.33
182 0.34
183 0.37
184 0.4
185 0.44
186 0.5
187 0.52
188 0.54
189 0.57
190 0.65
191 0.71
192 0.77
193 0.83
194 0.85
195 0.85
196 0.88
197 0.89
198 0.91
199 0.91
200 0.88
201 0.87
202 0.87
203 0.88
204 0.88
205 0.85
206 0.84
207 0.83
208 0.82
209 0.79
210 0.8
211 0.78
212 0.72
213 0.7
214 0.66
215 0.63
216 0.6
217 0.55
218 0.54
219 0.53
220 0.51
221 0.49
222 0.45
223 0.49
224 0.47
225 0.52
226 0.51
227 0.45
228 0.45
229 0.47
230 0.44
231 0.36
232 0.33
233 0.29
234 0.22
235 0.22
236 0.23
237 0.22
238 0.25
239 0.29