Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GNG1

Protein Details
Accession C1GNG1   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-80IGKTTTTPRKRGRKPVAEKNAGEHydrophilic
NLS Segment(s)
PositionSequence
65-72PRKRGRKP
93-110KQRVPSKAGKGGAGEKVK
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
KEGG pbl:PAAG_00056  -  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
Amino Acid Sequences MSQPTGLNKVEDDDEMMKYVNLSGDETNGDALKNVKQENVDQSTEVSNRNNGAKTKVIGKTTTTPRKRGRKPVAEKNAGENLNNDVDESPTKKQRVPSKAGKGGAGEKVKAGSRPMPTSLETASPEDKMLLRMKDEENKPWADIRQAWEEMTGEKVGNSSLSGRYSRIKANFVVFKKEDEERLLRYKKEIEEKFEAEKWRSVAEAIESNGGEKYPPTAVQKKFKELSKKMSNMAIRKENDVEDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.16
5 0.14
6 0.15
7 0.13
8 0.11
9 0.13
10 0.12
11 0.13
12 0.14
13 0.14
14 0.14
15 0.12
16 0.12
17 0.1
18 0.12
19 0.14
20 0.18
21 0.18
22 0.19
23 0.21
24 0.25
25 0.32
26 0.36
27 0.33
28 0.29
29 0.29
30 0.31
31 0.31
32 0.3
33 0.24
34 0.21
35 0.22
36 0.26
37 0.28
38 0.25
39 0.28
40 0.28
41 0.28
42 0.34
43 0.36
44 0.34
45 0.32
46 0.34
47 0.39
48 0.45
49 0.54
50 0.51
51 0.56
52 0.62
53 0.72
54 0.76
55 0.79
56 0.79
57 0.79
58 0.84
59 0.86
60 0.87
61 0.84
62 0.77
63 0.71
64 0.68
65 0.58
66 0.49
67 0.38
68 0.31
69 0.25
70 0.23
71 0.18
72 0.11
73 0.12
74 0.13
75 0.15
76 0.16
77 0.21
78 0.23
79 0.25
80 0.31
81 0.38
82 0.44
83 0.49
84 0.54
85 0.58
86 0.62
87 0.6
88 0.55
89 0.48
90 0.43
91 0.42
92 0.34
93 0.24
94 0.19
95 0.19
96 0.19
97 0.18
98 0.17
99 0.15
100 0.17
101 0.19
102 0.2
103 0.21
104 0.21
105 0.22
106 0.21
107 0.18
108 0.16
109 0.16
110 0.15
111 0.13
112 0.12
113 0.12
114 0.11
115 0.12
116 0.14
117 0.13
118 0.13
119 0.15
120 0.18
121 0.25
122 0.26
123 0.27
124 0.27
125 0.27
126 0.27
127 0.26
128 0.25
129 0.2
130 0.21
131 0.21
132 0.22
133 0.22
134 0.21
135 0.2
136 0.2
137 0.17
138 0.16
139 0.13
140 0.08
141 0.07
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.11
149 0.12
150 0.13
151 0.17
152 0.19
153 0.24
154 0.26
155 0.27
156 0.27
157 0.32
158 0.38
159 0.36
160 0.41
161 0.36
162 0.35
163 0.35
164 0.35
165 0.32
166 0.29
167 0.3
168 0.27
169 0.36
170 0.38
171 0.36
172 0.37
173 0.4
174 0.41
175 0.48
176 0.47
177 0.45
178 0.48
179 0.5
180 0.52
181 0.51
182 0.5
183 0.42
184 0.42
185 0.36
186 0.3
187 0.28
188 0.23
189 0.2
190 0.18
191 0.19
192 0.17
193 0.19
194 0.18
195 0.18
196 0.18
197 0.17
198 0.13
199 0.1
200 0.11
201 0.11
202 0.15
203 0.22
204 0.3
205 0.38
206 0.48
207 0.53
208 0.59
209 0.62
210 0.66
211 0.69
212 0.67
213 0.7
214 0.7
215 0.69
216 0.64
217 0.66
218 0.67
219 0.63
220 0.65
221 0.63
222 0.55
223 0.56
224 0.55