Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JVP7

Protein Details
Accession W4JVP7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-27AKHPPPTCAAQRQPHRPPRLLHydrophilic
36-56QPQPRPPHRASRPSRRRHGGGBasic
NLS Segment(s)
PositionSequence
30-65RAYARPQPQPRPPHRASRPSRRRHGGGRGRRAHRRA
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 6
Family & Domain DBs
KEGG hir:HETIRDRAFT_389239  -  
Amino Acid Sequences MPPAPHAKHPPPTCAAQRQPHRPPRLLLARAYARPQPQPRPPHRASRPSRRRHGGGRGRRAHRRAHADPYAPPTLRLSHRLIVGARPTPTMPAVAAVMSSRTRAVAVTVAGGSYRYHMYAHPLVLSPSSSVTVEAPPFLNRAHTVSVPPRPPLPSQLHSSPAHKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.61
4 0.67
5 0.72
6 0.78
7 0.81
8 0.81
9 0.75
10 0.69
11 0.69
12 0.7
13 0.63
14 0.54
15 0.52
16 0.51
17 0.49
18 0.5
19 0.45
20 0.39
21 0.44
22 0.49
23 0.5
24 0.52
25 0.6
26 0.65
27 0.69
28 0.69
29 0.71
30 0.73
31 0.75
32 0.75
33 0.76
34 0.79
35 0.78
36 0.84
37 0.8
38 0.77
39 0.73
40 0.75
41 0.74
42 0.74
43 0.75
44 0.75
45 0.74
46 0.78
47 0.74
48 0.7
49 0.67
50 0.66
51 0.59
52 0.58
53 0.56
54 0.49
55 0.48
56 0.47
57 0.45
58 0.36
59 0.32
60 0.26
61 0.25
62 0.25
63 0.27
64 0.24
65 0.22
66 0.22
67 0.23
68 0.22
69 0.2
70 0.21
71 0.19
72 0.16
73 0.15
74 0.14
75 0.14
76 0.13
77 0.12
78 0.09
79 0.07
80 0.07
81 0.06
82 0.06
83 0.05
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.08
105 0.15
106 0.17
107 0.17
108 0.17
109 0.17
110 0.17
111 0.17
112 0.17
113 0.12
114 0.1
115 0.11
116 0.1
117 0.1
118 0.11
119 0.13
120 0.13
121 0.13
122 0.14
123 0.13
124 0.15
125 0.14
126 0.16
127 0.14
128 0.17
129 0.19
130 0.19
131 0.24
132 0.29
133 0.38
134 0.38
135 0.39
136 0.4
137 0.4
138 0.41
139 0.44
140 0.45
141 0.41
142 0.45
143 0.46
144 0.49
145 0.49
146 0.5