Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1HBI3

Protein Details
Accession C1HBI3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-51EEDFMTDKMKRRRRKIHAICDKRYRQDBasic
NLS Segment(s)
PositionSequence
34-39KRRRRK
Subcellular Location(s) nucl 16, mito 6, cyto 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG pbl:PAAG_08124  -  
Amino Acid Sequences MDEKTVISSKAGSASAVDPIYPQNEEDFMTDKMKRRRRKIHAICDKRYRQDQRGGISKSWTHMLVVKLLLRLFKAGFFLGCMYLISCWYRRYQVHQRFAWFYSINIPANAFSSLLAYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.16
4 0.15
5 0.12
6 0.14
7 0.16
8 0.14
9 0.14
10 0.11
11 0.12
12 0.13
13 0.14
14 0.16
15 0.15
16 0.19
17 0.22
18 0.28
19 0.37
20 0.45
21 0.53
22 0.59
23 0.68
24 0.73
25 0.81
26 0.84
27 0.86
28 0.88
29 0.88
30 0.86
31 0.85
32 0.81
33 0.74
34 0.73
35 0.68
36 0.62
37 0.61
38 0.58
39 0.53
40 0.56
41 0.54
42 0.46
43 0.42
44 0.37
45 0.3
46 0.27
47 0.22
48 0.14
49 0.14
50 0.14
51 0.13
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.11
58 0.11
59 0.1
60 0.09
61 0.1
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.08
72 0.09
73 0.11
74 0.12
75 0.14
76 0.19
77 0.21
78 0.29
79 0.39
80 0.47
81 0.54
82 0.57
83 0.6
84 0.59
85 0.59
86 0.55
87 0.45
88 0.35
89 0.32
90 0.34
91 0.3
92 0.27
93 0.26
94 0.21
95 0.22
96 0.22
97 0.17
98 0.11