Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KG00

Protein Details
Accession W4KG00    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
210-230LTAVRRHREERVRKEEYRRLGBasic
NLS Segment(s)
PositionSequence
214-223RRHREERVRK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_433390  -  
Amino Acid Sequences MGRWSQFDGDSTRLPVGITRIAYDADTTRYMFQDTHGRRYIGAPGEEYGVMVPITAADALAPLGSKVSGKHTAKPAYDRPALFAGDAPAGSPLNSEFSSDDDDDVATKPPPPARRAHGHTRSPSAPSTFADILPPSLIAPAPPPPPPSSSHLPPSPFRAGKSRRAASTGDADAAPNPNATPARGEPEKERTWASRHPSMRLPSKAIGRTLTAVRRHREERVRKEEYRRLGAEGEKNGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.21
5 0.19
6 0.18
7 0.19
8 0.19
9 0.19
10 0.19
11 0.17
12 0.16
13 0.17
14 0.17
15 0.18
16 0.18
17 0.19
18 0.17
19 0.18
20 0.26
21 0.28
22 0.34
23 0.37
24 0.36
25 0.36
26 0.37
27 0.41
28 0.36
29 0.33
30 0.27
31 0.23
32 0.24
33 0.23
34 0.22
35 0.15
36 0.1
37 0.09
38 0.07
39 0.06
40 0.04
41 0.05
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.05
53 0.06
54 0.11
55 0.2
56 0.22
57 0.28
58 0.35
59 0.4
60 0.42
61 0.47
62 0.47
63 0.45
64 0.49
65 0.43
66 0.39
67 0.36
68 0.34
69 0.28
70 0.23
71 0.17
72 0.13
73 0.12
74 0.09
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.08
81 0.08
82 0.09
83 0.08
84 0.1
85 0.14
86 0.14
87 0.13
88 0.1
89 0.1
90 0.1
91 0.11
92 0.1
93 0.07
94 0.08
95 0.1
96 0.14
97 0.18
98 0.19
99 0.23
100 0.26
101 0.34
102 0.38
103 0.47
104 0.51
105 0.53
106 0.53
107 0.54
108 0.5
109 0.45
110 0.4
111 0.32
112 0.25
113 0.19
114 0.22
115 0.18
116 0.17
117 0.16
118 0.14
119 0.13
120 0.12
121 0.11
122 0.06
123 0.06
124 0.06
125 0.05
126 0.06
127 0.09
128 0.11
129 0.13
130 0.15
131 0.17
132 0.19
133 0.22
134 0.26
135 0.28
136 0.3
137 0.34
138 0.35
139 0.37
140 0.37
141 0.4
142 0.42
143 0.37
144 0.36
145 0.4
146 0.41
147 0.47
148 0.55
149 0.53
150 0.46
151 0.48
152 0.47
153 0.4
154 0.41
155 0.32
156 0.24
157 0.2
158 0.19
159 0.17
160 0.18
161 0.16
162 0.11
163 0.1
164 0.12
165 0.12
166 0.13
167 0.15
168 0.15
169 0.21
170 0.23
171 0.25
172 0.27
173 0.34
174 0.36
175 0.34
176 0.36
177 0.33
178 0.37
179 0.41
180 0.44
181 0.45
182 0.45
183 0.47
184 0.51
185 0.55
186 0.59
187 0.56
188 0.54
189 0.5
190 0.55
191 0.54
192 0.49
193 0.44
194 0.37
195 0.37
196 0.38
197 0.4
198 0.41
199 0.44
200 0.47
201 0.52
202 0.54
203 0.6
204 0.64
205 0.68
206 0.7
207 0.73
208 0.76
209 0.76
210 0.82
211 0.81
212 0.79
213 0.77
214 0.68
215 0.61
216 0.57
217 0.57
218 0.54