Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KIA4

Protein Details
Accession W4KIA4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-66RLNHRNRLRRLPKTCHPRRSABasic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 8, cyto 7.5, cyto_nucl 4.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_309190  -  
Amino Acid Sequences LGAHSTSTLISCLIFYLGAQFTIKTYIQLWNKPAFAPHSSELIRTRLNHRNRLRRLPKTCHPRRSASFATPSISKVITYNSLCIRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.1
9 0.14
10 0.14
11 0.11
12 0.12
13 0.19
14 0.23
15 0.26
16 0.3
17 0.29
18 0.3
19 0.29
20 0.29
21 0.25
22 0.23
23 0.23
24 0.21
25 0.22
26 0.21
27 0.23
28 0.23
29 0.23
30 0.23
31 0.2
32 0.26
33 0.3
34 0.35
35 0.43
36 0.49
37 0.57
38 0.62
39 0.71
40 0.74
41 0.76
42 0.78
43 0.77
44 0.77
45 0.78
46 0.82
47 0.8
48 0.76
49 0.74
50 0.71
51 0.71
52 0.67
53 0.61
54 0.58
55 0.5
56 0.48
57 0.41
58 0.38
59 0.32
60 0.27
61 0.22
62 0.17
63 0.18
64 0.23
65 0.23
66 0.27