Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K9K6

Protein Details
Accession W4K9K6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-25DGDTCTSSRRSRKRWDIPSPIGLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
KEGG hir:HETIRDRAFT_146198  -  
Amino Acid Sequences MDGDTCTSSRRSRKRWDIPSPIGLLAWIYEKLVTWTDDYQWGDDEVLTWVSIYWFSHAGPTAAICIYHEVGTAGGFLAPPRLAIPMGVSYFPKEICPVPRTWLRIIGNTSLWPRILKAAISPHMRGRMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.87
5 0.83
6 0.8
7 0.72
8 0.61
9 0.5
10 0.4
11 0.3
12 0.2
13 0.16
14 0.1
15 0.07
16 0.07
17 0.07
18 0.09
19 0.11
20 0.11
21 0.12
22 0.12
23 0.13
24 0.19
25 0.19
26 0.18
27 0.17
28 0.16
29 0.14
30 0.13
31 0.12
32 0.08
33 0.08
34 0.07
35 0.06
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.04
61 0.04
62 0.04
63 0.03
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.08
72 0.09
73 0.1
74 0.11
75 0.11
76 0.12
77 0.13
78 0.14
79 0.13
80 0.12
81 0.14
82 0.19
83 0.22
84 0.22
85 0.26
86 0.32
87 0.35
88 0.35
89 0.41
90 0.37
91 0.39
92 0.41
93 0.39
94 0.35
95 0.34
96 0.35
97 0.28
98 0.27
99 0.23
100 0.21
101 0.22
102 0.21
103 0.18
104 0.2
105 0.26
106 0.33
107 0.37
108 0.39
109 0.4