Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K5P3

Protein Details
Accession W4K5P3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
124-149GKPEPFPPPTHQKRRERSAHNRGILFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 7.5, mito 6, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007201  Mei2-like_Rrm_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG hir:HETIRDRAFT_319871  -  
Pfam View protein in Pfam  
PF04059  RRM_2  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences VDTRTTVMIKNIPNRMSDRDLLAFINNVCPGRIDFFYLRMDFQNGCNVGYAFVNFITVKDLLLFAKARLGTKWNMYSSEKILQMSYATYQGKEALIEKFKNSGIMDIREEWRPKIFYSDGLYQGKPEPFPPPTHQKRRERSAHNRGILFPPGAPRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.46
4 0.42
5 0.38
6 0.33
7 0.33
8 0.3
9 0.27
10 0.23
11 0.18
12 0.2
13 0.18
14 0.16
15 0.15
16 0.15
17 0.15
18 0.17
19 0.17
20 0.19
21 0.17
22 0.19
23 0.24
24 0.23
25 0.24
26 0.21
27 0.23
28 0.19
29 0.19
30 0.23
31 0.19
32 0.19
33 0.19
34 0.17
35 0.16
36 0.15
37 0.14
38 0.08
39 0.07
40 0.09
41 0.07
42 0.08
43 0.09
44 0.09
45 0.08
46 0.08
47 0.09
48 0.07
49 0.09
50 0.1
51 0.07
52 0.11
53 0.11
54 0.12
55 0.12
56 0.15
57 0.14
58 0.17
59 0.21
60 0.18
61 0.21
62 0.22
63 0.23
64 0.23
65 0.26
66 0.23
67 0.2
68 0.19
69 0.16
70 0.14
71 0.13
72 0.11
73 0.11
74 0.11
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.11
82 0.15
83 0.16
84 0.17
85 0.18
86 0.18
87 0.2
88 0.19
89 0.19
90 0.18
91 0.2
92 0.21
93 0.22
94 0.24
95 0.26
96 0.27
97 0.25
98 0.26
99 0.24
100 0.23
101 0.26
102 0.25
103 0.23
104 0.28
105 0.31
106 0.34
107 0.36
108 0.35
109 0.31
110 0.35
111 0.33
112 0.28
113 0.25
114 0.24
115 0.24
116 0.29
117 0.35
118 0.41
119 0.49
120 0.6
121 0.68
122 0.73
123 0.79
124 0.84
125 0.87
126 0.86
127 0.87
128 0.87
129 0.87
130 0.83
131 0.76
132 0.7
133 0.64
134 0.58
135 0.48
136 0.39
137 0.37