Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K4V8

Protein Details
Accession W4K4V8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-79VLLFLWLRKRCRRRRRIRAGLAPVPTHydrophilic
NLS Segment(s)
PositionSequence
62-71KRCRRRRRIR
Subcellular Location(s) cyto 8.5, extr 8, cyto_nucl 6, mito 5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG hir:HETIRDRAFT_101940  -  
Amino Acid Sequences MTDPQTSPSSATAPTHPLLAVNPSESASLKGHKAKTPIIAGVTTAGCLLLAWLVLLFLWLRKRCRRRRRIRAGLAPVPTRDDDDEDDERAPVRPKSTYIIPPDPAVLAGLRRPGEVVVGEPTVNGHRHGHGHGHGHDARPQAEGDGVAIDEGAIAGEEKHTGSRHSARGAFRAFASST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.19
5 0.18
6 0.2
7 0.18
8 0.15
9 0.15
10 0.15
11 0.16
12 0.16
13 0.18
14 0.16
15 0.18
16 0.21
17 0.27
18 0.31
19 0.33
20 0.37
21 0.37
22 0.4
23 0.4
24 0.37
25 0.32
26 0.28
27 0.24
28 0.23
29 0.19
30 0.14
31 0.11
32 0.08
33 0.06
34 0.06
35 0.06
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.05
45 0.12
46 0.16
47 0.22
48 0.31
49 0.42
50 0.53
51 0.64
52 0.73
53 0.78
54 0.86
55 0.91
56 0.93
57 0.92
58 0.91
59 0.88
60 0.82
61 0.75
62 0.65
63 0.54
64 0.45
65 0.36
66 0.28
67 0.2
68 0.17
69 0.14
70 0.17
71 0.18
72 0.17
73 0.17
74 0.15
75 0.15
76 0.15
77 0.15
78 0.11
79 0.11
80 0.11
81 0.12
82 0.15
83 0.19
84 0.23
85 0.28
86 0.31
87 0.3
88 0.3
89 0.29
90 0.26
91 0.21
92 0.16
93 0.1
94 0.07
95 0.07
96 0.11
97 0.1
98 0.1
99 0.11
100 0.1
101 0.11
102 0.1
103 0.1
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.12
110 0.12
111 0.13
112 0.12
113 0.13
114 0.16
115 0.18
116 0.21
117 0.22
118 0.26
119 0.25
120 0.31
121 0.32
122 0.31
123 0.34
124 0.32
125 0.3
126 0.25
127 0.24
128 0.18
129 0.16
130 0.14
131 0.11
132 0.09
133 0.08
134 0.06
135 0.06
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.05
145 0.06
146 0.09
147 0.1
148 0.12
149 0.19
150 0.26
151 0.3
152 0.36
153 0.41
154 0.41
155 0.48
156 0.49
157 0.44
158 0.38