Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KH96

Protein Details
Accession W4KH96    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
277-302AEARRAEARRVRKKEKERGKEVQAMLBasic
NLS Segment(s)
PositionSequence
279-296ARRAEARRVRKKEKERGK
Subcellular Location(s) nucl 19, cyto 6.5, cyto_mito 4.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_438153  -  
Amino Acid Sequences MSNTHDHLDLSRFPDHLGCSTGSLTHVFSDDSSQHHMDFDDTDMSPASPRQLTSHFPGLGFSAQTGSEDLDLELAPYSPSRRNFTLLPAMDEDEDEFPDTPQPSSPSSPSRRSFASLPDIDMDDTISPSHPTPSPRLLSLPGADTDDDLLLPAFSYIPNSEPPPPDGPSLGLFVPIAVAEEPHIADSPPEEEPDLNFSWDARARVDAAELDKLVALRRRAWFLERNAKRTEQSYAEEAQRIAAGLRVSPPVPGALADVQLQAGLDPKGAIRRELQVAEARRAEARRVRKKEKERGKEVQAMLRLKLDDGVGAGTPEAPADAVVQRDERGKVVIGSFSQLVARMIFKRRDASRVLANKKTPGDYVCSSLSRGVSPDFEDVNSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.26
4 0.25
5 0.21
6 0.21
7 0.21
8 0.21
9 0.19
10 0.18
11 0.17
12 0.14
13 0.14
14 0.13
15 0.12
16 0.16
17 0.16
18 0.18
19 0.23
20 0.23
21 0.23
22 0.23
23 0.23
24 0.2
25 0.19
26 0.18
27 0.16
28 0.15
29 0.16
30 0.16
31 0.15
32 0.15
33 0.15
34 0.17
35 0.15
36 0.15
37 0.18
38 0.22
39 0.26
40 0.3
41 0.37
42 0.34
43 0.33
44 0.32
45 0.31
46 0.29
47 0.24
48 0.19
49 0.12
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.11
65 0.16
66 0.2
67 0.26
68 0.27
69 0.31
70 0.31
71 0.36
72 0.42
73 0.37
74 0.36
75 0.32
76 0.32
77 0.28
78 0.27
79 0.23
80 0.15
81 0.15
82 0.13
83 0.11
84 0.1
85 0.14
86 0.14
87 0.13
88 0.14
89 0.16
90 0.18
91 0.21
92 0.25
93 0.3
94 0.36
95 0.44
96 0.44
97 0.45
98 0.43
99 0.44
100 0.41
101 0.38
102 0.4
103 0.32
104 0.31
105 0.29
106 0.28
107 0.25
108 0.23
109 0.18
110 0.1
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.11
117 0.12
118 0.15
119 0.19
120 0.24
121 0.25
122 0.25
123 0.27
124 0.26
125 0.26
126 0.24
127 0.21
128 0.16
129 0.15
130 0.14
131 0.13
132 0.11
133 0.09
134 0.08
135 0.06
136 0.06
137 0.04
138 0.04
139 0.04
140 0.04
141 0.03
142 0.05
143 0.05
144 0.07
145 0.08
146 0.11
147 0.14
148 0.15
149 0.19
150 0.21
151 0.22
152 0.21
153 0.2
154 0.19
155 0.16
156 0.17
157 0.14
158 0.11
159 0.09
160 0.08
161 0.08
162 0.06
163 0.06
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.12
181 0.12
182 0.1
183 0.1
184 0.09
185 0.11
186 0.13
187 0.14
188 0.1
189 0.1
190 0.11
191 0.11
192 0.11
193 0.1
194 0.09
195 0.1
196 0.09
197 0.08
198 0.08
199 0.08
200 0.1
201 0.12
202 0.12
203 0.16
204 0.17
205 0.2
206 0.21
207 0.25
208 0.29
209 0.33
210 0.42
211 0.42
212 0.45
213 0.45
214 0.46
215 0.43
216 0.39
217 0.35
218 0.28
219 0.26
220 0.25
221 0.25
222 0.25
223 0.25
224 0.23
225 0.19
226 0.16
227 0.14
228 0.11
229 0.1
230 0.08
231 0.07
232 0.09
233 0.1
234 0.1
235 0.1
236 0.1
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.09
243 0.09
244 0.09
245 0.09
246 0.08
247 0.08
248 0.06
249 0.07
250 0.06
251 0.06
252 0.06
253 0.07
254 0.13
255 0.13
256 0.15
257 0.15
258 0.19
259 0.22
260 0.22
261 0.24
262 0.25
263 0.28
264 0.31
265 0.3
266 0.27
267 0.27
268 0.28
269 0.31
270 0.32
271 0.39
272 0.46
273 0.54
274 0.63
275 0.69
276 0.79
277 0.84
278 0.88
279 0.87
280 0.85
281 0.84
282 0.82
283 0.8
284 0.73
285 0.68
286 0.64
287 0.56
288 0.48
289 0.43
290 0.36
291 0.27
292 0.26
293 0.2
294 0.13
295 0.11
296 0.11
297 0.08
298 0.08
299 0.08
300 0.07
301 0.06
302 0.06
303 0.05
304 0.04
305 0.04
306 0.06
307 0.08
308 0.09
309 0.11
310 0.12
311 0.14
312 0.18
313 0.19
314 0.18
315 0.18
316 0.18
317 0.18
318 0.19
319 0.2
320 0.17
321 0.18
322 0.18
323 0.16
324 0.16
325 0.15
326 0.14
327 0.12
328 0.15
329 0.18
330 0.25
331 0.29
332 0.32
333 0.39
334 0.41
335 0.46
336 0.46
337 0.46
338 0.49
339 0.55
340 0.59
341 0.59
342 0.6
343 0.61
344 0.61
345 0.58
346 0.51
347 0.44
348 0.43
349 0.37
350 0.38
351 0.36
352 0.33
353 0.32
354 0.32
355 0.31
356 0.26
357 0.26
358 0.23
359 0.21
360 0.23
361 0.25
362 0.23