Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2V6T0

Protein Details
Accession A0A0A2V6T0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LKENTPKRARKMERNYEASDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
KEGG pbl:PAAG_11393  -  
Amino Acid Sequences MFLKENTPKRARKMERNYEASDPKSLNLDDMRGSDDMVEWLELLGHSAHTSTSSTTIKIVTEHKNRLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.77
5 0.72
6 0.69
7 0.6
8 0.53
9 0.42
10 0.34
11 0.3
12 0.26
13 0.21
14 0.17
15 0.16
16 0.13
17 0.13
18 0.14
19 0.11
20 0.11
21 0.09
22 0.08
23 0.08
24 0.07
25 0.06
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.12
40 0.13
41 0.13
42 0.14
43 0.15
44 0.15
45 0.17
46 0.23
47 0.28
48 0.35
49 0.42