Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KAX8

Protein Details
Accession W4KAX8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-41VEIPRSGTQRERRPRRTRRSMAIVRRHydrophilic
NLS Segment(s)
PositionSequence
25-35RERRPRRTRRS
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_450663  -  
Amino Acid Sequences MHSTPDLPPDPVDAPVEIPRSGTQRERRPRRTRRSMAIVRRAPWRDDDDRERERIQHSLHCSLFKGTPRDDKALTKPKPASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.19
5 0.19
6 0.2
7 0.22
8 0.24
9 0.3
10 0.34
11 0.41
12 0.52
13 0.61
14 0.7
15 0.77
16 0.85
17 0.87
18 0.9
19 0.87
20 0.83
21 0.83
22 0.81
23 0.79
24 0.79
25 0.71
26 0.63
27 0.63
28 0.57
29 0.48
30 0.42
31 0.39
32 0.33
33 0.35
34 0.39
35 0.39
36 0.4
37 0.43
38 0.41
39 0.38
40 0.36
41 0.35
42 0.32
43 0.3
44 0.33
45 0.36
46 0.37
47 0.35
48 0.35
49 0.32
50 0.34
51 0.34
52 0.33
53 0.31
54 0.39
55 0.42
56 0.46
57 0.46
58 0.47
59 0.52
60 0.57
61 0.56
62 0.56