Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JVP3

Protein Details
Accession W4JVP3   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-41LIAKFSKIRLRKSRKQSRCLLVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10.5, nucl 8, cysk 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_174968  -  
Amino Acid Sequences MEYTPSLAIPICSSTLGDLLIAKFSKIRLRKSRKQSRCLLVPHIVSDINRSIVRDRPCILNVRLPKSVSTQILVASHDVEMLLQSLAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.11
8 0.11
9 0.1
10 0.11
11 0.12
12 0.2
13 0.24
14 0.33
15 0.41
16 0.5
17 0.59
18 0.7
19 0.79
20 0.8
21 0.83
22 0.82
23 0.77
24 0.75
25 0.69
26 0.63
27 0.56
28 0.48
29 0.4
30 0.33
31 0.27
32 0.2
33 0.19
34 0.15
35 0.13
36 0.12
37 0.12
38 0.13
39 0.18
40 0.22
41 0.23
42 0.23
43 0.25
44 0.26
45 0.31
46 0.31
47 0.33
48 0.36
49 0.38
50 0.4
51 0.38
52 0.37
53 0.37
54 0.4
55 0.34
56 0.29
57 0.24
58 0.23
59 0.23
60 0.23
61 0.19
62 0.14
63 0.13
64 0.11
65 0.1
66 0.08
67 0.07
68 0.07