Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JXA0

Protein Details
Accession W4JXA0   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-173VRGVGGKETKRRKFWREGVPBasic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.833, mito 8.5, cyto_mito 8.166, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
KEGG hir:HETIRDRAFT_105372  -  
Amino Acid Sequences MLNISSLKSLTIGPGHTHSKDVILSLLEGTPNLEILDIYYDAFLEDFYELAPASYPGLRQLHDLTVRHQGVALKHQFAALFKWIQAVVPTPSLEHLELVSDDSRECKYSQTFVEMIRQYPSLKTLTVPSVHLTNSEFKQTVAQCSRLSTLYFTVRGVGGKETKRRKFWREGVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.27
4 0.28
5 0.26
6 0.25
7 0.24
8 0.22
9 0.18
10 0.13
11 0.13
12 0.12
13 0.12
14 0.1
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.06
21 0.05
22 0.05
23 0.08
24 0.07
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.11
44 0.13
45 0.13
46 0.15
47 0.17
48 0.2
49 0.24
50 0.24
51 0.22
52 0.29
53 0.29
54 0.27
55 0.26
56 0.24
57 0.21
58 0.28
59 0.28
60 0.2
61 0.2
62 0.21
63 0.2
64 0.18
65 0.18
66 0.13
67 0.11
68 0.1
69 0.11
70 0.1
71 0.1
72 0.1
73 0.1
74 0.08
75 0.09
76 0.09
77 0.08
78 0.09
79 0.1
80 0.1
81 0.09
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.1
93 0.12
94 0.13
95 0.16
96 0.16
97 0.19
98 0.19
99 0.19
100 0.27
101 0.25
102 0.24
103 0.23
104 0.23
105 0.2
106 0.19
107 0.21
108 0.14
109 0.14
110 0.14
111 0.15
112 0.17
113 0.18
114 0.18
115 0.18
116 0.18
117 0.18
118 0.18
119 0.17
120 0.19
121 0.19
122 0.22
123 0.21
124 0.19
125 0.26
126 0.26
127 0.33
128 0.32
129 0.34
130 0.31
131 0.33
132 0.35
133 0.3
134 0.3
135 0.23
136 0.23
137 0.24
138 0.25
139 0.22
140 0.22
141 0.21
142 0.21
143 0.2
144 0.21
145 0.23
146 0.29
147 0.39
148 0.48
149 0.55
150 0.64
151 0.71
152 0.74
153 0.78