Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K358

Protein Details
Accession W4K358    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-38CTSLWQCSRSLRSRRPRSNRNSGACRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_418295  -  
Amino Acid Sequences MAEMTQRSCSSCTSLWQCSRSLRSRRPRSNRNSGACRLVGSESSVASNTSVATLSPSGGPATRPSACRLRTQRYLHGERTLLFPGVVQGYCFAMNIDVHGYLQRSLFCLRHES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.43
4 0.45
5 0.46
6 0.52
7 0.54
8 0.57
9 0.59
10 0.64
11 0.73
12 0.81
13 0.85
14 0.87
15 0.87
16 0.89
17 0.88
18 0.86
19 0.82
20 0.74
21 0.69
22 0.59
23 0.5
24 0.4
25 0.32
26 0.23
27 0.18
28 0.15
29 0.11
30 0.11
31 0.1
32 0.09
33 0.08
34 0.08
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.11
49 0.13
50 0.14
51 0.18
52 0.24
53 0.26
54 0.34
55 0.39
56 0.42
57 0.49
58 0.53
59 0.57
60 0.59
61 0.63
62 0.57
63 0.55
64 0.49
65 0.4
66 0.4
67 0.33
68 0.25
69 0.19
70 0.16
71 0.14
72 0.15
73 0.14
74 0.1
75 0.09
76 0.1
77 0.11
78 0.11
79 0.09
80 0.08
81 0.08
82 0.09
83 0.1
84 0.09
85 0.1
86 0.12
87 0.13
88 0.13
89 0.14
90 0.14
91 0.15
92 0.18
93 0.2