Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JPS1

Protein Details
Accession W4JPS1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-114IPGIRKLSNKRTKPRREHQEVSHydrophilic
NLS Segment(s)
PositionSequence
97-107RKLSNKRTKPR
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_331157  -  
Amino Acid Sequences MPPSPSSRTIHKTMNHTGLQGWGDGTDPCPRVCSSLQHMVLYFSTVCRLPGVVLDRQGQAPNVPESLRTMVQPNTAAFAERKRLCRGTKSADIPGIRKLSNKRTKPRREHQEVSIGLVLLLKMCAEGIERRAPQVSSVFDMVYKGHKILGNDCYVSNLSHMLIWCQRGEVGKLHYVDLSRSREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.54
3 0.49
4 0.44
5 0.41
6 0.35
7 0.28
8 0.21
9 0.13
10 0.13
11 0.12
12 0.13
13 0.16
14 0.17
15 0.16
16 0.19
17 0.19
18 0.22
19 0.24
20 0.28
21 0.28
22 0.36
23 0.38
24 0.36
25 0.36
26 0.34
27 0.32
28 0.28
29 0.21
30 0.12
31 0.12
32 0.11
33 0.11
34 0.1
35 0.1
36 0.08
37 0.12
38 0.15
39 0.16
40 0.18
41 0.2
42 0.21
43 0.22
44 0.23
45 0.19
46 0.16
47 0.17
48 0.15
49 0.14
50 0.13
51 0.12
52 0.14
53 0.16
54 0.16
55 0.14
56 0.15
57 0.15
58 0.17
59 0.18
60 0.15
61 0.15
62 0.14
63 0.15
64 0.13
65 0.14
66 0.2
67 0.22
68 0.25
69 0.27
70 0.32
71 0.33
72 0.38
73 0.41
74 0.39
75 0.42
76 0.42
77 0.4
78 0.39
79 0.39
80 0.34
81 0.34
82 0.29
83 0.23
84 0.24
85 0.26
86 0.33
87 0.41
88 0.48
89 0.54
90 0.62
91 0.72
92 0.78
93 0.83
94 0.83
95 0.83
96 0.79
97 0.73
98 0.71
99 0.61
100 0.55
101 0.45
102 0.34
103 0.25
104 0.21
105 0.17
106 0.08
107 0.08
108 0.04
109 0.03
110 0.03
111 0.03
112 0.05
113 0.07
114 0.1
115 0.17
116 0.17
117 0.19
118 0.21
119 0.2
120 0.21
121 0.23
122 0.21
123 0.17
124 0.18
125 0.17
126 0.15
127 0.16
128 0.15
129 0.15
130 0.15
131 0.12
132 0.15
133 0.17
134 0.18
135 0.22
136 0.26
137 0.26
138 0.26
139 0.26
140 0.25
141 0.24
142 0.23
143 0.19
144 0.15
145 0.12
146 0.13
147 0.13
148 0.15
149 0.17
150 0.19
151 0.18
152 0.18
153 0.2
154 0.2
155 0.22
156 0.23
157 0.24
158 0.28
159 0.29
160 0.29
161 0.29
162 0.28
163 0.3
164 0.32