Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KN14

Protein Details
Accession W4KN14    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-50QVYPWVQPRRHPRRRRHPRSTPHRPRYPPQLDBasic
135-154VSLKCRGLHRVKKVDRGSNFHydrophilic
NLS Segment(s)
PositionSequence
27-43RRHPRRRRHPRSTPHRP
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6
Family & Domain DBs
KEGG hir:HETIRDRAFT_447205  -  
Amino Acid Sequences MRRIEPHHPSIASVLTQAQVYPWVQPRRHPRRRRHPRSTPHRPRYPPQLDEDYLMKTVDYRDAASPCPQPRSSFALAPALFDDSAALDIAHYEEPTTATTTDENATAPMIPATAGARSKKMKTICARVVNLIHAVSLKCRGLHRVKKVDRGSNFDLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.14
3 0.14
4 0.13
5 0.11
6 0.12
7 0.12
8 0.16
9 0.23
10 0.31
11 0.32
12 0.4
13 0.51
14 0.59
15 0.69
16 0.74
17 0.76
18 0.8
19 0.9
20 0.93
21 0.93
22 0.92
23 0.92
24 0.94
25 0.94
26 0.94
27 0.93
28 0.92
29 0.86
30 0.82
31 0.82
32 0.78
33 0.7
34 0.64
35 0.61
36 0.52
37 0.48
38 0.44
39 0.35
40 0.28
41 0.24
42 0.18
43 0.12
44 0.11
45 0.12
46 0.11
47 0.11
48 0.13
49 0.14
50 0.16
51 0.19
52 0.24
53 0.23
54 0.27
55 0.26
56 0.25
57 0.27
58 0.32
59 0.31
60 0.27
61 0.26
62 0.28
63 0.27
64 0.26
65 0.22
66 0.17
67 0.14
68 0.13
69 0.12
70 0.05
71 0.05
72 0.05
73 0.04
74 0.03
75 0.03
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.08
84 0.07
85 0.08
86 0.08
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.07
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.08
101 0.11
102 0.12
103 0.18
104 0.22
105 0.24
106 0.29
107 0.32
108 0.37
109 0.42
110 0.5
111 0.54
112 0.58
113 0.58
114 0.56
115 0.55
116 0.48
117 0.43
118 0.33
119 0.25
120 0.19
121 0.17
122 0.15
123 0.18
124 0.18
125 0.18
126 0.2
127 0.28
128 0.36
129 0.45
130 0.54
131 0.6
132 0.65
133 0.73
134 0.79
135 0.8
136 0.75
137 0.74
138 0.7