Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KCG9

Protein Details
Accession W4KCG9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-104PENPNRGKEPKPRKPKATKAPKKKKVVEEEEEBasic
NLS Segment(s)
PositionSequence
77-97NRGKEPKPRKPKATKAPKKKK
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG hir:HETIRDRAFT_439796  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTASETTTKAATRRSNAKSTRSSEPGTKPKRAPSAYNLFVQANMKPWLEANQGKSVKEAMAQIGSMWKDAPENPNRGKEPKPRKPKATKAPKKKKVVEEEEEQEEREEEAEGPQVEPSSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.52
4 0.55
5 0.59
6 0.64
7 0.65
8 0.63
9 0.64
10 0.59
11 0.56
12 0.54
13 0.58
14 0.61
15 0.59
16 0.61
17 0.57
18 0.6
19 0.65
20 0.61
21 0.56
22 0.53
23 0.56
24 0.52
25 0.5
26 0.45
27 0.36
28 0.34
29 0.31
30 0.24
31 0.18
32 0.18
33 0.16
34 0.14
35 0.14
36 0.16
37 0.19
38 0.21
39 0.21
40 0.27
41 0.28
42 0.28
43 0.29
44 0.26
45 0.21
46 0.2
47 0.17
48 0.09
49 0.08
50 0.08
51 0.07
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.09
59 0.16
60 0.18
61 0.25
62 0.28
63 0.34
64 0.36
65 0.39
66 0.44
67 0.48
68 0.54
69 0.58
70 0.66
71 0.68
72 0.76
73 0.82
74 0.86
75 0.87
76 0.87
77 0.88
78 0.88
79 0.92
80 0.91
81 0.91
82 0.89
83 0.88
84 0.86
85 0.85
86 0.79
87 0.75
88 0.7
89 0.67
90 0.6
91 0.51
92 0.41
93 0.33
94 0.28
95 0.2
96 0.17
97 0.1
98 0.1
99 0.15
100 0.14
101 0.14
102 0.15
103 0.15