Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KJJ3

Protein Details
Accession W4KJJ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
107-126GAVRKFPRRKAEKWRSTGREBasic
NLS Segment(s)
PositionSequence
110-120RKFPRRKAEKW
Subcellular Location(s) mito 16, cyto 9
Family & Domain DBs
KEGG hir:HETIRDRAFT_100861  -  
Amino Acid Sequences MRGSPVLLCDFPAKMDRRASPARGAVRCGAVPIGSRPALAGAAGAAGPAWFSLVQRVQPADRSRICVGSGVIEDSYWGQLSGCCSGPTVGWGGVGYWSGGMARDGAGAVRKFPRRKAEKWRSTGRELPVDRDGSVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.33
4 0.39
5 0.45
6 0.46
7 0.44
8 0.48
9 0.51
10 0.47
11 0.48
12 0.43
13 0.39
14 0.36
15 0.31
16 0.24
17 0.17
18 0.16
19 0.15
20 0.18
21 0.15
22 0.15
23 0.14
24 0.14
25 0.13
26 0.11
27 0.09
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.03
38 0.04
39 0.07
40 0.08
41 0.1
42 0.11
43 0.13
44 0.13
45 0.18
46 0.21
47 0.24
48 0.24
49 0.27
50 0.27
51 0.27
52 0.26
53 0.21
54 0.19
55 0.14
56 0.13
57 0.09
58 0.08
59 0.07
60 0.07
61 0.06
62 0.07
63 0.05
64 0.05
65 0.04
66 0.05
67 0.07
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.11
94 0.11
95 0.14
96 0.21
97 0.29
98 0.33
99 0.4
100 0.49
101 0.52
102 0.6
103 0.68
104 0.73
105 0.75
106 0.8
107 0.84
108 0.8
109 0.8
110 0.78
111 0.73
112 0.72
113 0.63
114 0.6
115 0.56
116 0.51