Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JZQ8

Protein Details
Accession W4JZQ8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-36IITNIKRPHKVRRTNKVQIVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_419839  -  
Amino Acid Sequences MITFCRALRAVYSDTIITNIKRPHKVRRTNKVQIVTLVIHSQRITLSLRAWNAALQTTHTSGIELLVFPGRKETNGETQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.17
5 0.2
6 0.25
7 0.3
8 0.38
9 0.41
10 0.5
11 0.58
12 0.68
13 0.72
14 0.77
15 0.8
16 0.81
17 0.83
18 0.78
19 0.69
20 0.59
21 0.51
22 0.41
23 0.32
24 0.25
25 0.19
26 0.14
27 0.13
28 0.12
29 0.09
30 0.1
31 0.11
32 0.1
33 0.11
34 0.14
35 0.14
36 0.15
37 0.15
38 0.14
39 0.13
40 0.14
41 0.12
42 0.11
43 0.13
44 0.14
45 0.15
46 0.14
47 0.14
48 0.12
49 0.13
50 0.11
51 0.09
52 0.08
53 0.12
54 0.13
55 0.12
56 0.18
57 0.18
58 0.19
59 0.23
60 0.27