Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JZ03

Protein Details
Accession W4JZ03   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-102TPNRSRPPAHHPPPRRRRPRAGSTTPSBasic
NLS Segment(s)
PositionSequence
79-96RSRPPAHHPPPRRRRPRA
Subcellular Location(s) mito 14, nucl 8, extr 3
Family & Domain DBs
KEGG hir:HETIRDRAFT_165480  -  
Amino Acid Sequences MVRLSTVYRYVLVEVPASATKPCPISAPCAYTRALLGAQVFILGKLQGETRIVREQLQRNGTARFVSRHEHNAHLTPNRSRPPAHHPPPRRRRPRAGSTTPSSAAPPRPYPTPYPRPQTPYTSPPPSAPTPSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.16
5 0.15
6 0.14
7 0.15
8 0.16
9 0.16
10 0.17
11 0.17
12 0.23
13 0.27
14 0.3
15 0.3
16 0.3
17 0.31
18 0.27
19 0.26
20 0.21
21 0.17
22 0.13
23 0.12
24 0.1
25 0.09
26 0.09
27 0.09
28 0.07
29 0.07
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.08
36 0.09
37 0.12
38 0.16
39 0.16
40 0.19
41 0.25
42 0.3
43 0.34
44 0.36
45 0.35
46 0.33
47 0.33
48 0.31
49 0.26
50 0.21
51 0.17
52 0.16
53 0.17
54 0.18
55 0.22
56 0.24
57 0.25
58 0.26
59 0.26
60 0.28
61 0.29
62 0.3
63 0.27
64 0.32
65 0.33
66 0.33
67 0.31
68 0.31
69 0.37
70 0.44
71 0.5
72 0.53
73 0.59
74 0.69
75 0.79
76 0.86
77 0.87
78 0.85
79 0.86
80 0.85
81 0.87
82 0.85
83 0.83
84 0.8
85 0.75
86 0.72
87 0.62
88 0.54
89 0.45
90 0.39
91 0.36
92 0.34
93 0.33
94 0.31
95 0.33
96 0.36
97 0.42
98 0.48
99 0.52
100 0.55
101 0.59
102 0.62
103 0.65
104 0.66
105 0.67
106 0.64
107 0.62
108 0.63
109 0.62
110 0.57
111 0.53
112 0.55
113 0.51
114 0.52