Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KP08

Protein Details
Accession W4KP08    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
109-135GPAPHRRCPLPRRPRPRHRPPAPSTSPBasic
NLS Segment(s)
PositionSequence
35-81RARASGRKTGTRPRTTAVRRRGRSRSPSPSPSPPPSPPPHTARTTRL
101-187TRTRTRSTGPAPHRRCPLPRRPRPRHRPPAPSTSPRPPRRAPARARARARAQAAPGSGGSGRARAPCGAAARARARGARREPSRGAR
Subcellular Location(s) mito 16, extr 5, nucl 4
Family & Domain DBs
KEGG hir:HETIRDRAFT_167147  -  
Amino Acid Sequences MGRAGARAARAARGRAAARAAVEVDLDLVAAVAARARASGRKTGTRPRTTAVRRRGRSRSPSPSPSPPPSPPPHTARTTRLRAPARTAIGATATATTRTRTRTRTRSTGPAPHRRCPLPRRPRPRHRPPAPSTSPRPPRRAPARARARARAQAAPGSGGSGRARAPCGAAARARARGARREPSRGARSISASRSSSRVPCPVLSLVFCFLGTPTSVRPSVRPSFTTPRPRYTRALSWFLGRSPPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.34
4 0.29
5 0.27
6 0.26
7 0.24
8 0.18
9 0.17
10 0.13
11 0.11
12 0.09
13 0.08
14 0.05
15 0.04
16 0.04
17 0.03
18 0.03
19 0.04
20 0.04
21 0.04
22 0.05
23 0.07
24 0.12
25 0.15
26 0.22
27 0.26
28 0.34
29 0.4
30 0.5
31 0.59
32 0.61
33 0.61
34 0.58
35 0.63
36 0.64
37 0.68
38 0.68
39 0.69
40 0.68
41 0.73
42 0.78
43 0.77
44 0.78
45 0.78
46 0.77
47 0.75
48 0.77
49 0.74
50 0.75
51 0.73
52 0.69
53 0.66
54 0.59
55 0.59
56 0.57
57 0.57
58 0.54
59 0.53
60 0.52
61 0.51
62 0.52
63 0.52
64 0.54
65 0.54
66 0.53
67 0.56
68 0.55
69 0.52
70 0.53
71 0.52
72 0.45
73 0.4
74 0.36
75 0.27
76 0.22
77 0.21
78 0.15
79 0.1
80 0.08
81 0.09
82 0.09
83 0.1
84 0.12
85 0.17
86 0.21
87 0.26
88 0.35
89 0.42
90 0.48
91 0.55
92 0.56
93 0.6
94 0.61
95 0.64
96 0.63
97 0.65
98 0.63
99 0.61
100 0.61
101 0.56
102 0.58
103 0.57
104 0.6
105 0.6
106 0.65
107 0.7
108 0.76
109 0.84
110 0.88
111 0.91
112 0.91
113 0.88
114 0.88
115 0.82
116 0.82
117 0.77
118 0.74
119 0.68
120 0.67
121 0.69
122 0.65
123 0.66
124 0.58
125 0.6
126 0.63
127 0.67
128 0.63
129 0.63
130 0.68
131 0.71
132 0.73
133 0.7
134 0.66
135 0.62
136 0.6
137 0.52
138 0.43
139 0.37
140 0.33
141 0.28
142 0.23
143 0.18
144 0.14
145 0.14
146 0.12
147 0.11
148 0.12
149 0.12
150 0.13
151 0.12
152 0.13
153 0.14
154 0.16
155 0.17
156 0.17
157 0.22
158 0.23
159 0.26
160 0.27
161 0.28
162 0.29
163 0.34
164 0.4
165 0.44
166 0.45
167 0.49
168 0.53
169 0.58
170 0.61
171 0.56
172 0.53
173 0.46
174 0.47
175 0.46
176 0.44
177 0.4
178 0.36
179 0.34
180 0.34
181 0.35
182 0.34
183 0.33
184 0.35
185 0.32
186 0.31
187 0.33
188 0.33
189 0.31
190 0.28
191 0.26
192 0.22
193 0.2
194 0.19
195 0.15
196 0.13
197 0.12
198 0.11
199 0.11
200 0.11
201 0.15
202 0.18
203 0.19
204 0.22
205 0.28
206 0.35
207 0.37
208 0.38
209 0.42
210 0.48
211 0.57
212 0.66
213 0.63
214 0.66
215 0.69
216 0.7
217 0.69
218 0.67
219 0.67
220 0.63
221 0.65
222 0.56
223 0.55
224 0.52
225 0.48
226 0.47