Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K6P4

Protein Details
Accession W4K6P4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-46DFSIDMDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG hir:HETIRDRAFT_317558  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDFDFSIDMDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGLTGLCVYEVDDPALRDDPTIDEPTRLRNRIAELESLVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.74
3 0.79
4 0.85
5 0.86
6 0.89
7 0.89
8 0.88
9 0.82
10 0.75
11 0.71
12 0.63
13 0.57
14 0.58
15 0.55
16 0.57
17 0.62
18 0.69
19 0.72
20 0.8
21 0.85
22 0.86
23 0.91
24 0.9
25 0.87
26 0.86
27 0.81
28 0.76
29 0.7
30 0.61
31 0.52
32 0.46
33 0.39
34 0.29
35 0.25
36 0.18
37 0.13
38 0.1
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.11
46 0.12
47 0.12
48 0.1
49 0.11
50 0.13
51 0.16
52 0.2
53 0.18
54 0.19
55 0.2
56 0.3
57 0.37
58 0.36
59 0.34
60 0.32
61 0.37
62 0.42
63 0.44
64 0.37
65 0.32
66 0.35
67 0.35