Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2UZN6

Protein Details
Accession A0A0A2UZN6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-33MEGPKREKEKEKEKEDKKDEAcidic
NLS Segment(s)
PositionSequence
19-25REKEKEK
Subcellular Location(s) cyto 13, nucl 11.5, mito_nucl 7.5
Family & Domain DBs
KEGG pbl:PAAG_12652  -  
Amino Acid Sequences MCLCWGTPYKAFMMEGPKREKEKEKEKEDKKDENVQFYLVQPGDQFVPVSVSVIIYPPLLESDWTPFTLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.44
5 0.45
6 0.49
7 0.55
8 0.54
9 0.59
10 0.62
11 0.66
12 0.7
13 0.74
14 0.8
15 0.78
16 0.77
17 0.71
18 0.71
19 0.64
20 0.58
21 0.51
22 0.42
23 0.36
24 0.29
25 0.28
26 0.17
27 0.16
28 0.11
29 0.11
30 0.1
31 0.1
32 0.1
33 0.06
34 0.08
35 0.08
36 0.09
37 0.08
38 0.08
39 0.07
40 0.08
41 0.09
42 0.07
43 0.07
44 0.06
45 0.08
46 0.08
47 0.08
48 0.09
49 0.14
50 0.16