Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K3I0

Protein Details
Accession W4K3I0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-127ARKAEASKQRKRKVEKAERAGGKASRTKNTKNTRNTKNTKGKKRBasic
NLS Segment(s)
PositionSequence
60-127HPHPHPHPHPLKPRTKNPKYGTIAARKAEASKQRKRKVEKAERAGGKASRTKNTKNTRNTKNTKGKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
KEGG hir:HETIRDRAFT_101530  -  
Amino Acid Sequences GEEQFATVTVVEDFDPSTLLHGDPSAPPPPNPLTSTSTSTSASSPTQSKPKPKTPQDTPHPHPHPHPHPLKPRTKNPKYGTIAARKAEASKQRKRKVEKAERAGGKASRTKNTKNTRNTKNTKGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.1
10 0.11
11 0.15
12 0.18
13 0.19
14 0.19
15 0.23
16 0.26
17 0.28
18 0.28
19 0.28
20 0.28
21 0.31
22 0.35
23 0.32
24 0.31
25 0.29
26 0.28
27 0.24
28 0.21
29 0.18
30 0.17
31 0.17
32 0.19
33 0.26
34 0.29
35 0.38
36 0.43
37 0.52
38 0.59
39 0.64
40 0.69
41 0.69
42 0.74
43 0.75
44 0.77
45 0.72
46 0.73
47 0.7
48 0.63
49 0.58
50 0.57
51 0.52
52 0.52
53 0.53
54 0.5
55 0.56
56 0.62
57 0.68
58 0.67
59 0.72
60 0.75
61 0.75
62 0.77
63 0.71
64 0.73
65 0.68
66 0.68
67 0.64
68 0.62
69 0.61
70 0.52
71 0.49
72 0.39
73 0.36
74 0.35
75 0.38
76 0.38
77 0.43
78 0.53
79 0.6
80 0.68
81 0.74
82 0.77
83 0.79
84 0.82
85 0.82
86 0.8
87 0.81
88 0.77
89 0.71
90 0.67
91 0.59
92 0.53
93 0.49
94 0.46
95 0.45
96 0.47
97 0.52
98 0.57
99 0.66
100 0.7
101 0.73
102 0.78
103 0.8
104 0.85
105 0.86
106 0.87
107 0.87