Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JZZ9

Protein Details
Accession W4JZZ9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
95-115VSEKSEKKKQEVRPRVPASRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002777  PFD_beta-like  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
KEGG hir:HETIRDRAFT_326000  -  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
CDD cd00632  Prefoldin_beta  
Amino Acid Sequences MSLEARLQAASADFQKLQAELADAVEARQRLDAQLSENELVRKEFAVLTPKNVVYKMIGPVLVKQEQAEATANVAKRLEFIRSEIKRMEAHLQSVSEKSEKKKQEVRPRVPASRVARPTADRCARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.16
5 0.13
6 0.13
7 0.1
8 0.1
9 0.1
10 0.09
11 0.1
12 0.12
13 0.12
14 0.1
15 0.11
16 0.11
17 0.1
18 0.13
19 0.13
20 0.13
21 0.16
22 0.18
23 0.18
24 0.19
25 0.19
26 0.18
27 0.17
28 0.15
29 0.12
30 0.1
31 0.1
32 0.11
33 0.17
34 0.17
35 0.19
36 0.22
37 0.22
38 0.22
39 0.22
40 0.2
41 0.14
42 0.16
43 0.15
44 0.13
45 0.13
46 0.12
47 0.14
48 0.17
49 0.17
50 0.15
51 0.13
52 0.13
53 0.12
54 0.13
55 0.12
56 0.09
57 0.09
58 0.12
59 0.12
60 0.11
61 0.12
62 0.1
63 0.1
64 0.11
65 0.12
66 0.1
67 0.13
68 0.22
69 0.23
70 0.27
71 0.26
72 0.28
73 0.27
74 0.29
75 0.33
76 0.24
77 0.25
78 0.24
79 0.24
80 0.23
81 0.23
82 0.23
83 0.21
84 0.23
85 0.26
86 0.32
87 0.36
88 0.43
89 0.5
90 0.58
91 0.66
92 0.73
93 0.77
94 0.79
95 0.82
96 0.8
97 0.75
98 0.74
99 0.69
100 0.68
101 0.64
102 0.57
103 0.54
104 0.53
105 0.55
106 0.56