Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JZK4

Protein Details
Accession W4JZK4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-38IRLRSNQTIKQRKNRSHKLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.333
Family & Domain DBs
KEGG hir:HETIRDRAFT_419798  -  
Amino Acid Sequences MRASSPGPFMATCSRRNRIRLRSNQTIKQRKNRSHKLIWPCLALKLDAVPRCSPVLCRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.56
4 0.62
5 0.63
6 0.69
7 0.72
8 0.73
9 0.77
10 0.78
11 0.78
12 0.8
13 0.8
14 0.76
15 0.76
16 0.76
17 0.75
18 0.78
19 0.81
20 0.78
21 0.76
22 0.77
23 0.77
24 0.76
25 0.7
26 0.63
27 0.54
28 0.5
29 0.43
30 0.35
31 0.26
32 0.21
33 0.25
34 0.25
35 0.28
36 0.25
37 0.27
38 0.29
39 0.29