Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KGZ3

Protein Details
Accession W4KGZ3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-36ASRPHPSRPPVPQRPVPRRPVPRPCACTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 8, cyto 4.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_308594  -  
Amino Acid Sequences MPSGTKVRASRPHPSRPPVPQRPVPRRPVPRPCACTSLPHVPSPDMQPRQPFFFPLPPTPLTPDRSRTPPCASPPAFRHNLHSQPFHPSYLPPARPMTGCNPLASSMSALAISPAPPSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.74
4 0.79
5 0.79
6 0.79
7 0.77
8 0.79
9 0.82
10 0.83
11 0.81
12 0.8
13 0.8
14 0.82
15 0.84
16 0.82
17 0.81
18 0.8
19 0.74
20 0.7
21 0.61
22 0.56
23 0.51
24 0.52
25 0.45
26 0.4
27 0.38
28 0.33
29 0.34
30 0.34
31 0.37
32 0.3
33 0.3
34 0.34
35 0.34
36 0.38
37 0.36
38 0.33
39 0.27
40 0.29
41 0.31
42 0.27
43 0.29
44 0.26
45 0.26
46 0.28
47 0.29
48 0.27
49 0.26
50 0.28
51 0.27
52 0.32
53 0.34
54 0.35
55 0.37
56 0.38
57 0.4
58 0.44
59 0.43
60 0.43
61 0.44
62 0.47
63 0.47
64 0.43
65 0.46
66 0.44
67 0.49
68 0.47
69 0.47
70 0.4
71 0.43
72 0.45
73 0.4
74 0.34
75 0.26
76 0.31
77 0.36
78 0.36
79 0.31
80 0.32
81 0.33
82 0.32
83 0.35
84 0.33
85 0.33
86 0.32
87 0.3
88 0.28
89 0.28
90 0.28
91 0.26
92 0.21
93 0.13
94 0.12
95 0.12
96 0.1
97 0.1
98 0.1
99 0.09
100 0.09