Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KFB2

Protein Details
Accession W4KFB2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDSPPKKDNQRRKEREKKGRERQKITLVRVBasic
85-108AANPPRPPRPPPPRPPRKGWCGSRBasic
NLS Segment(s)
PositionSequence
6-23KKDNQRRKEREKKGRERQ
58-102RPPPPPPLPPAPGGPPPRVSPAAAKPLAANPPRPPRPPPPRPPRK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
KEGG hir:HETIRDRAFT_170906  -  
Amino Acid Sequences MDSPPKKDNQRRKEREKKGRERQKITLVRVCYAATARCAHASPPPPPPPPLPDSPFARPPPPPPLPPAPGGPPPRVSPAAAKPLAANPPRPPRPPPPRPPRKGWCGSRSLSAILTSGAAPLRFCAEREGGWLARAGRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.94
5 0.94
6 0.95
7 0.94
8 0.91
9 0.87
10 0.86
11 0.84
12 0.79
13 0.75
14 0.66
15 0.57
16 0.51
17 0.43
18 0.34
19 0.28
20 0.22
21 0.18
22 0.18
23 0.17
24 0.17
25 0.18
26 0.17
27 0.21
28 0.24
29 0.25
30 0.32
31 0.37
32 0.37
33 0.4
34 0.41
35 0.4
36 0.4
37 0.43
38 0.37
39 0.36
40 0.38
41 0.4
42 0.44
43 0.41
44 0.39
45 0.34
46 0.34
47 0.38
48 0.37
49 0.34
50 0.32
51 0.35
52 0.35
53 0.35
54 0.34
55 0.28
56 0.32
57 0.33
58 0.3
59 0.27
60 0.26
61 0.28
62 0.27
63 0.24
64 0.21
65 0.22
66 0.28
67 0.26
68 0.25
69 0.22
70 0.24
71 0.31
72 0.28
73 0.27
74 0.27
75 0.37
76 0.42
77 0.44
78 0.47
79 0.5
80 0.59
81 0.67
82 0.71
83 0.72
84 0.78
85 0.81
86 0.85
87 0.83
88 0.82
89 0.81
90 0.79
91 0.74
92 0.69
93 0.65
94 0.6
95 0.54
96 0.46
97 0.37
98 0.29
99 0.23
100 0.17
101 0.16
102 0.11
103 0.1
104 0.11
105 0.1
106 0.09
107 0.1
108 0.14
109 0.14
110 0.14
111 0.17
112 0.18
113 0.18
114 0.22
115 0.27
116 0.23
117 0.23
118 0.26
119 0.24