Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KH52

Protein Details
Accession W4KH52   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-118DASKLTTKSAKKNEKRKEKRKEKREEVVRESWDBasic
NLS Segment(s)
PositionSequence
93-109KSAKKNEKRKEKRKEKR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
KEGG hir:HETIRDRAFT_243245  -  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSKPPLHPKQSTAGIAVDPRTLERVIPESRRPDGTVRKQIRIRPGYTPQEDVQRFRGTRQQALDSRALPIGHIIGWTPPPSTPQRDASKLTTKSAKKNEKRKEKRKEKREEVVRESWDSDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.3
4 0.24
5 0.17
6 0.16
7 0.17
8 0.15
9 0.14
10 0.14
11 0.18
12 0.22
13 0.27
14 0.32
15 0.34
16 0.37
17 0.39
18 0.39
19 0.4
20 0.45
21 0.49
22 0.54
23 0.54
24 0.59
25 0.61
26 0.63
27 0.66
28 0.62
29 0.55
30 0.5
31 0.54
32 0.54
33 0.51
34 0.51
35 0.42
36 0.46
37 0.44
38 0.4
39 0.36
40 0.34
41 0.32
42 0.3
43 0.35
44 0.28
45 0.3
46 0.3
47 0.32
48 0.29
49 0.32
50 0.33
51 0.27
52 0.26
53 0.24
54 0.22
55 0.15
56 0.13
57 0.1
58 0.07
59 0.07
60 0.06
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.12
67 0.16
68 0.21
69 0.24
70 0.3
71 0.35
72 0.39
73 0.43
74 0.45
75 0.51
76 0.48
77 0.48
78 0.49
79 0.48
80 0.53
81 0.59
82 0.64
83 0.64
84 0.73
85 0.79
86 0.82
87 0.89
88 0.9
89 0.92
90 0.92
91 0.94
92 0.94
93 0.94
94 0.93
95 0.92
96 0.92
97 0.9
98 0.86
99 0.84
100 0.78
101 0.7
102 0.62