Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KAR9

Protein Details
Accession W4KAR9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
117-136YGFYPITSKRKLKRKAIALRHydrophilic
NLS Segment(s)
PositionSequence
125-135KRKLKRKAIAL
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_416633  -  
Amino Acid Sequences MLQLDNPFEFLPLRSESTTPSATDTRLQSLPLADNLSSPCDESIAHGESTSQASSSPSSSSIDTASLERRVHEEPPTTQSVSVQIQPSSSDPTMISVPLSSTNQAGLGHAFGEPVEYGFYPITSKRKLKRKAIALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.26
5 0.27
6 0.24
7 0.25
8 0.23
9 0.23
10 0.27
11 0.26
12 0.26
13 0.25
14 0.25
15 0.21
16 0.22
17 0.22
18 0.19
19 0.19
20 0.15
21 0.15
22 0.16
23 0.17
24 0.15
25 0.14
26 0.12
27 0.1
28 0.1
29 0.1
30 0.14
31 0.13
32 0.13
33 0.12
34 0.13
35 0.13
36 0.15
37 0.13
38 0.09
39 0.07
40 0.08
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.1
52 0.11
53 0.13
54 0.13
55 0.13
56 0.15
57 0.16
58 0.17
59 0.19
60 0.19
61 0.18
62 0.22
63 0.25
64 0.22
65 0.21
66 0.19
67 0.2
68 0.19
69 0.2
70 0.18
71 0.15
72 0.14
73 0.16
74 0.17
75 0.18
76 0.17
77 0.14
78 0.13
79 0.15
80 0.15
81 0.14
82 0.13
83 0.08
84 0.09
85 0.11
86 0.12
87 0.11
88 0.1
89 0.11
90 0.12
91 0.12
92 0.11
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.06
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.09
105 0.09
106 0.1
107 0.11
108 0.16
109 0.22
110 0.28
111 0.37
112 0.44
113 0.54
114 0.64
115 0.72
116 0.77