Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JWR9

Protein Details
Accession W4JWR9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-104DERPMPKGPMFPRRRRRRARRAESSQPETSBasic
NLS Segment(s)
PositionSequence
81-96KGPMFPRRRRRRARRA
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
KEGG hir:HETIRDRAFT_325045  -  
Amino Acid Sequences REDPGAPLPSPKDLIKEYRLSNAESGLGTDYTKRRNVIRIRMEGEQFLLQAADVAGVVDWIEGFQAAANIALDLDERPMPKGPMFPRRRRRRARRAESSQPETS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.38
4 0.37
5 0.41
6 0.42
7 0.39
8 0.36
9 0.31
10 0.27
11 0.21
12 0.2
13 0.14
14 0.12
15 0.1
16 0.14
17 0.16
18 0.19
19 0.22
20 0.23
21 0.23
22 0.31
23 0.38
24 0.44
25 0.48
26 0.49
27 0.5
28 0.51
29 0.5
30 0.41
31 0.36
32 0.27
33 0.19
34 0.13
35 0.1
36 0.06
37 0.06
38 0.05
39 0.03
40 0.03
41 0.03
42 0.02
43 0.02
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.06
62 0.07
63 0.08
64 0.1
65 0.12
66 0.14
67 0.15
68 0.22
69 0.27
70 0.36
71 0.45
72 0.54
73 0.63
74 0.73
75 0.83
76 0.87
77 0.92
78 0.92
79 0.94
80 0.94
81 0.94
82 0.93
83 0.93
84 0.91