Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JX50

Protein Details
Accession W4JX50   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-44ANNAGHKTSKKPPAKPPAKPLADHydrophilic
294-313GVGVLLNRRKHPKKAPVDDHBasic
NLS Segment(s)
PositionSequence
28-39KTSKKPPAKPPA
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007849  ATP10  
KEGG hir:HETIRDRAFT_326185  -  
Pfam View protein in Pfam  
PF05176  ATP-synt_10  
Amino Acid Sequences MLASTLRRTQHTPTRAFIRHAANNAGHKTSKKPPAKPPAKPLADDSSTKPFQAPSSPPMFHLIPPLQRPLGVPDVPTTAVKTWSEMSADMLNQEKQLAKRRHLLFSEMPPRRVKQASTGYFYDLHMTRVHGGKTWMAPGVLIRQDKALYFPDIVGTKLDDGVQTHTTNICSGRISVIAMLSTKISEQHAASYTTRVNEMYRNHPSYQYIQINLQENFLKSLLVNMFLSSLRGQVPPHLQTTYLISRQNMEYVREQLGMVNSRIGYVYLVDEQLKVRWAASADAKTEEEEALIRGVGVLLNRRKHPKKAPVDDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.6
4 0.59
5 0.57
6 0.54
7 0.54
8 0.54
9 0.49
10 0.52
11 0.51
12 0.48
13 0.43
14 0.39
15 0.42
16 0.45
17 0.51
18 0.53
19 0.58
20 0.64
21 0.72
22 0.8
23 0.82
24 0.82
25 0.83
26 0.78
27 0.71
28 0.66
29 0.63
30 0.57
31 0.51
32 0.46
33 0.44
34 0.41
35 0.39
36 0.35
37 0.28
38 0.26
39 0.31
40 0.3
41 0.27
42 0.34
43 0.34
44 0.34
45 0.38
46 0.37
47 0.31
48 0.34
49 0.32
50 0.3
51 0.33
52 0.36
53 0.31
54 0.3
55 0.31
56 0.28
57 0.3
58 0.25
59 0.23
60 0.21
61 0.23
62 0.23
63 0.23
64 0.2
65 0.15
66 0.17
67 0.17
68 0.17
69 0.16
70 0.16
71 0.16
72 0.14
73 0.15
74 0.14
75 0.14
76 0.14
77 0.15
78 0.14
79 0.13
80 0.15
81 0.15
82 0.17
83 0.27
84 0.31
85 0.32
86 0.41
87 0.44
88 0.49
89 0.47
90 0.49
91 0.43
92 0.47
93 0.53
94 0.48
95 0.47
96 0.44
97 0.44
98 0.44
99 0.42
100 0.33
101 0.32
102 0.38
103 0.39
104 0.41
105 0.41
106 0.38
107 0.37
108 0.36
109 0.31
110 0.22
111 0.19
112 0.15
113 0.15
114 0.15
115 0.16
116 0.16
117 0.14
118 0.14
119 0.15
120 0.15
121 0.15
122 0.14
123 0.11
124 0.11
125 0.1
126 0.13
127 0.15
128 0.14
129 0.13
130 0.13
131 0.14
132 0.14
133 0.16
134 0.14
135 0.11
136 0.11
137 0.11
138 0.12
139 0.12
140 0.12
141 0.1
142 0.09
143 0.08
144 0.08
145 0.08
146 0.06
147 0.06
148 0.09
149 0.11
150 0.11
151 0.11
152 0.12
153 0.12
154 0.12
155 0.12
156 0.1
157 0.08
158 0.08
159 0.09
160 0.08
161 0.08
162 0.07
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.06
171 0.07
172 0.08
173 0.08
174 0.1
175 0.12
176 0.15
177 0.15
178 0.16
179 0.17
180 0.16
181 0.17
182 0.15
183 0.14
184 0.17
185 0.2
186 0.25
187 0.31
188 0.34
189 0.35
190 0.36
191 0.37
192 0.36
193 0.41
194 0.36
195 0.3
196 0.28
197 0.31
198 0.34
199 0.32
200 0.31
201 0.24
202 0.22
203 0.22
204 0.2
205 0.16
206 0.11
207 0.15
208 0.13
209 0.14
210 0.13
211 0.11
212 0.13
213 0.12
214 0.14
215 0.1
216 0.11
217 0.1
218 0.12
219 0.12
220 0.15
221 0.21
222 0.22
223 0.25
224 0.24
225 0.23
226 0.22
227 0.28
228 0.29
229 0.27
230 0.27
231 0.25
232 0.27
233 0.28
234 0.32
235 0.28
236 0.26
237 0.25
238 0.26
239 0.28
240 0.26
241 0.25
242 0.22
243 0.25
244 0.25
245 0.22
246 0.21
247 0.19
248 0.18
249 0.18
250 0.16
251 0.12
252 0.1
253 0.12
254 0.1
255 0.12
256 0.12
257 0.13
258 0.14
259 0.15
260 0.16
261 0.15
262 0.13
263 0.14
264 0.14
265 0.17
266 0.23
267 0.25
268 0.25
269 0.28
270 0.28
271 0.27
272 0.27
273 0.23
274 0.17
275 0.14
276 0.13
277 0.11
278 0.1
279 0.09
280 0.07
281 0.07
282 0.08
283 0.09
284 0.17
285 0.24
286 0.3
287 0.37
288 0.47
289 0.54
290 0.62
291 0.7
292 0.73
293 0.77