Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KFB5

Protein Details
Accession W4KFB5   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
250-294RQAGKEMKKPEPKERKRHVDGESGEQPPQKKRRQKPAPDLEQANEBasic
NLS Segment(s)
PositionSequence
244-285KRAERARQAGKEMKKPEPKERKRHVDGESGEQPPQKKRRQKP
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039119  ABT1/Esf2  
IPR034353  ABT1/ESF2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003676  F:nucleic acid binding  
KEGG hir:HETIRDRAFT_314375  -  
CDD cd12263  RRM_ABT1_like  
Amino Acid Sequences MTTSKAIASRSDPRFIVDSRSDEEHEAGSSRSGLKEASRGTDSEDNEPHEEGDALEDGQDEEYGLIEGMDPSGFAGPKVVKPLTSEALAAFNAAHDRAGVIYISRIPPGMRPTKVRHLMSQYGEVGRVYLQQEDAKRAYLRRKYTSTKKAHFTEGWVEFKDKKVARSIADMLNAQPIGGKKGTRWRDDIWTMKYLPKFKWNMLTEQVAHEAAIHTARLRVELSQSKTEQKEYLKNVELARVLDKRAERARQAGKEMKKPEPKERKRHVDGESGEQPPQKKRRQKPAPDLEQANEQLKSVLGSIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.41
4 0.36
5 0.36
6 0.34
7 0.38
8 0.37
9 0.35
10 0.35
11 0.28
12 0.24
13 0.21
14 0.18
15 0.15
16 0.14
17 0.14
18 0.14
19 0.14
20 0.14
21 0.14
22 0.2
23 0.21
24 0.24
25 0.24
26 0.24
27 0.29
28 0.34
29 0.34
30 0.35
31 0.36
32 0.35
33 0.35
34 0.35
35 0.29
36 0.24
37 0.22
38 0.15
39 0.14
40 0.11
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.04
57 0.04
58 0.04
59 0.06
60 0.06
61 0.06
62 0.09
63 0.11
64 0.12
65 0.18
66 0.18
67 0.17
68 0.19
69 0.24
70 0.23
71 0.22
72 0.21
73 0.16
74 0.17
75 0.17
76 0.14
77 0.1
78 0.08
79 0.08
80 0.08
81 0.07
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.05
88 0.05
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.12
95 0.19
96 0.24
97 0.24
98 0.29
99 0.35
100 0.44
101 0.52
102 0.5
103 0.48
104 0.48
105 0.51
106 0.47
107 0.45
108 0.37
109 0.29
110 0.28
111 0.24
112 0.18
113 0.12
114 0.13
115 0.1
116 0.09
117 0.1
118 0.12
119 0.13
120 0.17
121 0.17
122 0.17
123 0.17
124 0.2
125 0.27
126 0.31
127 0.36
128 0.38
129 0.43
130 0.48
131 0.57
132 0.63
133 0.64
134 0.63
135 0.64
136 0.61
137 0.59
138 0.52
139 0.45
140 0.42
141 0.37
142 0.34
143 0.28
144 0.28
145 0.24
146 0.25
147 0.3
148 0.24
149 0.21
150 0.25
151 0.26
152 0.26
153 0.29
154 0.31
155 0.25
156 0.26
157 0.25
158 0.19
159 0.19
160 0.17
161 0.13
162 0.12
163 0.1
164 0.11
165 0.12
166 0.12
167 0.12
168 0.21
169 0.28
170 0.29
171 0.33
172 0.33
173 0.39
174 0.44
175 0.48
176 0.43
177 0.4
178 0.38
179 0.39
180 0.4
181 0.37
182 0.33
183 0.36
184 0.35
185 0.33
186 0.41
187 0.39
188 0.39
189 0.39
190 0.4
191 0.33
192 0.32
193 0.31
194 0.22
195 0.2
196 0.16
197 0.13
198 0.1
199 0.1
200 0.08
201 0.07
202 0.09
203 0.09
204 0.1
205 0.1
206 0.1
207 0.16
208 0.23
209 0.27
210 0.3
211 0.33
212 0.38
213 0.39
214 0.41
215 0.39
216 0.37
217 0.4
218 0.4
219 0.45
220 0.42
221 0.44
222 0.42
223 0.42
224 0.39
225 0.32
226 0.33
227 0.28
228 0.25
229 0.26
230 0.26
231 0.29
232 0.35
233 0.39
234 0.36
235 0.42
236 0.5
237 0.5
238 0.56
239 0.58
240 0.58
241 0.61
242 0.64
243 0.65
244 0.66
245 0.68
246 0.71
247 0.74
248 0.77
249 0.8
250 0.85
251 0.86
252 0.83
253 0.85
254 0.79
255 0.77
256 0.7
257 0.67
258 0.64
259 0.56
260 0.52
261 0.47
262 0.46
263 0.46
264 0.53
265 0.54
266 0.58
267 0.65
268 0.73
269 0.81
270 0.88
271 0.9
272 0.92
273 0.91
274 0.89
275 0.84
276 0.75
277 0.72
278 0.65
279 0.58
280 0.47
281 0.37
282 0.29
283 0.25
284 0.23