Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K067

Protein Details
Accession W4K067   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-93AVSPRSRRPTPPPNRRLTRTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 7.833
Family & Domain DBs
KEGG hir:HETIRDRAFT_386668  -  
Amino Acid Sequences MRTPMKLSLSLSILPRSVSRPLTVPFLPVRDDFKSKRNQARPKLATLRTSHFKDLSSDTPGSTYDDFPSPDFAVSPRSRRPTPPPNRRLTRTSGNCDCSGSTGIRRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.24
5 0.22
6 0.21
7 0.23
8 0.24
9 0.29
10 0.27
11 0.28
12 0.25
13 0.25
14 0.26
15 0.23
16 0.26
17 0.24
18 0.3
19 0.29
20 0.34
21 0.42
22 0.47
23 0.55
24 0.61
25 0.66
26 0.69
27 0.78
28 0.74
29 0.72
30 0.72
31 0.66
32 0.61
33 0.54
34 0.51
35 0.46
36 0.46
37 0.4
38 0.33
39 0.3
40 0.27
41 0.28
42 0.24
43 0.22
44 0.2
45 0.18
46 0.17
47 0.17
48 0.18
49 0.15
50 0.14
51 0.11
52 0.13
53 0.14
54 0.14
55 0.16
56 0.14
57 0.13
58 0.12
59 0.12
60 0.18
61 0.2
62 0.25
63 0.28
64 0.34
65 0.37
66 0.42
67 0.5
68 0.54
69 0.62
70 0.68
71 0.71
72 0.75
73 0.81
74 0.81
75 0.77
76 0.73
77 0.73
78 0.69
79 0.69
80 0.67
81 0.64
82 0.59
83 0.56
84 0.49
85 0.41
86 0.36
87 0.3
88 0.31